y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G035506_T01
FamilyAA2
Protein PropertiesLength: 323 Molecular Weight: 33796.1 Isoelectric Point: 6.9596
ChromosomeChromosome/Scaffold: 5 Start: 145215467 End: 145216705
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2513040
  VASNRRMGASLVRLFFHDCFVQGCDASILLDDVPGSFVGEKTAGPNANSVLGYDVINSIKTAVEANCPGVVSCADIVALAARDGTVLLGGPSWNVPLGRH
  DSTTASLSQANSDLPSPASSLSTLIAKFGNKGLSPTDMTALSGAHSVGFAQCRNYRNRIYNDADINQQFAKLLRTNCSATQGASDTNLAPLDVATQLSFD
  NAYYGNLLKKKGLLHSDQELFNGGSQDALVQNYSSNANFFFADFVTAMIKMGNI
Full Sequence
Protein Sequence     Length: 323     Download
MASSTTGHCI FLALLLLLAS TACYGQLSTS FYSTSCPALE STVRSVVSSA VASNRRMGAS    60
LVRLFFHDCF VQGCDASILL DDVPGSFVGE KTAGPNANSV LGYDVINSIK TAVEANCPGV    120
VSCADIVALA ARDGTVLLGG PSWNVPLGRH DSTTASLSQA NSDLPSPASS LSTLIAKFGN    180
KGLSPTDMTA LSGAHSVGFA QCRNYRNRIY NDADINQQFA KLLRTNCSAT QGASDTNLAP    240
LDVATQLSFD NAYYGNLLKK KGLLHSDQEL FNGGSQDALV QNYSSNANFF FADFVTAMIK    300
MGNINPLNGT AGQIRAKCSV VN*                                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase8.0e-961301260+
cd00314plant_peroxidase_like3.0e-2557303279+
PLN03030PLN030303.0e-6331322304+
pfam00141peroxidase1.0e-6457197141+
cd00693secretory_peroxidase7.0e-13926321303+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD28869.1013221325putative bacterial-induced peroxidase precursor [Oryza sativa Japonica Group]
GenBankEAY85148.1013221321hypothetical protein OsI_06503 [Oryza sativa Indica Group]
RefSeqNP_001046400.1013229333Os02g0240100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130666.1013221322hypothetical protein LOC100191769 [Zea mays]
RefSeqXP_002451850.1023223323hypothetical protein SORBIDRAFT_04g008650 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0263221294A Chain A, Peanut Peroxidase
PDB1sch_A0263221294A Chain A, Peanut Peroxidase
PDB1qo4_A0263222304A Chain A, Peanut Peroxidase
PDB1pa2_A0263222304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0253222305A Chain A, Raphanus Sativus Anionic Peroxidase.
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR432298299243220
CJ930655265583220
DN551857298263230
CK244541267573230
CK247774293263180