Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G036752_T03 |
Family | CBM43 |
Protein Properties | Length: 111 Molecular Weight: 11717.2 Isoelectric Point: 6.726 |
Chromosome | Chromosome/Scaffold: 2 Start: 209584090 End: 209586003 |
Description | plasmodesmata callose-binding protein 3 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 22 | 100 | 1.5e-32 |
WCVCRQDASQAALQKTIDYACGSGADCNSIHETGACYNPNTVPAHCSWAANSYYQNNKAKGATCDFAGTATLTTSDPSK |
Full Sequence |
---|
Protein Sequence Length: 111 Download |
MEALLVTVLL LLLSSTLAAA QWCVCRQDAS QAALQKTIDY ACGSGADCNS IHETGACYNP 60 NTVPAHCSWA ANSYYQNNKA KGATCDFAGT ATLTTSDPSK WNQRTIMHAV * 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-20 | 21 | 92 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 9.0e-34 | 21 | 99 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF83296.1 | 0 | 21 | 99 | 20 | 98 | unknown [Zea mays] |
GenBank | ACG32291.1 | 0 | 1 | 100 | 1 | 100 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
GenBank | ACG46419.1 | 0 | 21 | 99 | 20 | 98 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
RefSeq | NP_001148400.1 | 0 | 21 | 99 | 20 | 98 | glucan endo-1,3-beta-glucosidase 3 [Zea mays] |
RefSeq | XP_002460971.1 | 0 | 21 | 99 | 20 | 98 | hypothetical protein SORBIDRAFT_02g038510 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-18 | 18 | 99 | 9 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |