CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G046618_T01
FamilyCE8
Protein PropertiesLength: 600 Molecular Weight: 61188.8 Isoelectric Point: 5.0849
ChromosomeChromosome/Scaffold: 9 Start: 11627635 End: 11630361
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82895830
  ITVAKDGTGNFRTVGEAVAAAPNNSEARTVIRVKAGTYEENVEVLPYKKNIALVGEGRDTTVITGSRSAADGWTTFRSATFGVSGEGFLARDITFRNTAG
  AGKGQAVALRVNADLAALYRCGVEGHQDALYAHSFRQFYRECAVSGTVDVVFGDAAAVLQGCALLARAPVPGQSVVLTAHGRADPNEDTGIALHHCTVSA
  SAADPAPAGTRTFLGRPWGAYARAVVMDSYLGQIVDREGWAEWPGAEPGRADTVYFGEYGNDGPGADTGGRVGWAGVRQMEYDEAAQFAVENFIY
Full Sequence
Protein Sequence     Length: 600     Download
MAAVTFSPPL LLAILLILTT ASTTQCHGHK SQRHHTGGTR VAQKTAAAGA SPPADTVHHA    60
ICHTTPHPVS CLLAVASHLG AVAGAKAAEA SAVSVQLLPP NVLSVALASL NGAESALSSL    120
SPALSALSAP AASPAGASLR RGAAQDCQDL HAATLWSLSR SASLLAAPGE SLPAVRAHLA    180
AALANKATCL DGLAGASGPR VGGLLASLDD AYEHVSNSLA LVARRGGGVS AAGFVDVVAK    240
TIHNRRLLQD DDDDDGNGGD DDNDNGGDDN DGGADNGGNT GQPAAATVIT VAKDGTGNFR    300
TVGEAVAAAP NNSEARTVIR VKAGTYEENV EVLPYKKNIA LVGEGRDTTV ITGSRSAADG    360
WTTFRSATFG VSGEGFLARD ITFRNTAGAG KGQAVALRVN ADLAALYRCG VEGHQDALYA    420
HSFRQFYREC AVSGTVDVVF GDAAAVLQGC ALLARAPVPG QSVVLTAHGR ADPNEDTGIA    480
LHHCTVSASA ADPAPAGTRT FLGRPWGAYA RAVVMDSYLG QIVDREGWAE WPGAEPGRAD    540
TVYFGEYGND GPGADTGGRV GWAGVRQMEY DEAAQFAVEN FIYGDEWLGA TSFPYDDDV*    600

Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02314PLN023144.0e-121289597311+
PLN02713PLN027136.0e-124287595314+
PLN03043PLN030439.0e-125289595313+
PLN02416PLN024169.0e-147191599410+
pfam01095Pectinesterase3.0e-157289585299+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE65248.105359952550hypothetical protein OsJ_20428 [Oryza sativa Japonica Group]
RefSeqNP_001057041.105359952585Os06g0193200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_180212.105359932547pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002436630.1015991606hypothetical protein SORBIDRAFT_10g006230 [Sorghum bicolor]
RefSeqXP_002516192.106159947543Pectinesterase PPE8B precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02895959315A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02915977313B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B3e-2129955418311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A3e-2129955418311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B3e-2129955418311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE0430852283736000
EE0272682651914550
EE1874592551914450
FE6116652093926000
FL8368262093926000