| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G047968_T03 |
| Family | AA2 |
| Protein Properties | Length: 197 Molecular Weight: 20900.9 Isoelectric Point: 9.8525 |
| Chromosome | Chromosome/Scaffold: 1 Start: 189686174 End: 189687836 |
| Description | ascorbate peroxidase 6 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 90 | 196 | 2.5e-33 |
| KGKAAGVLRLVFHDAGTFEIGDGSGGMNGSIIYEVDRPENIGLNRSIKILRKAKEGIDNVQKVSWADLIAVAGAEAVALCGGPEIPVRLGRVDSSSADPS GKVPEET | |||
| Full Sequence |
|---|
| Protein Sequence Length: 197 Download |
| MYRGTRDGKL VTKASAAGRK RAADSVCSQL SEQGTEDSIS GPRSSWRIRR RDLASAILLP 60 FLIPRVNISI AAEIYDASII RSGVRSVLTK GKAAGVLRLV FHDAGTFEIG DGSGGMNGSI 120 IYEVDRPENI GLNRSIKILR KAKEGIDNVQ KVSWADLIAV AGAEAVALCG GPEIPVRLGR 180 VDSSSADPSG KVPEETL 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02879 | PLN02879 | 2.0e-15 | 96 | 196 | 103 | + L-ascorbate peroxidase | ||
| cd08201 | plant_peroxidase_like_1 | 2.0e-22 | 93 | 194 | 104 | + Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. | ||
| pfam00141 | peroxidase | 2.0e-25 | 88 | 190 | 109 | + Peroxidase. | ||
| cd00691 | ascorbate_peroxidase | 2.0e-26 | 64 | 193 | 136 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| cd00314 | plant_peroxidase_like | 1.0e-30 | 78 | 197 | 127 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAZ07678.1 | 0 | 6 | 197 | 28 | 220 | hypothetical protein OsI_29935 [Oryza sativa Indica Group] |
| GenBank | EAZ43377.1 | 0 | 6 | 197 | 28 | 220 | hypothetical protein OsJ_27981 [Oryza sativa Japonica Group] |
| RefSeq | NP_001062280.1 | 0 | 96 | 197 | 1 | 102 | Os08g0522400 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002282677.1 | 0 | 50 | 197 | 65 | 219 | PREDICTED: similar to APX6 (ASCORBATE PEROXIDASE 6); L-ascorbate peroxidase [Vitis vinifera] |
| RefSeq | XP_002445876.1 | 0 | 3 | 197 | 28 | 222 | hypothetical protein SORBIDRAFT_07g027300 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1apx_D | 0.00000000000003 | 84 | 196 | 22 | 134 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_C | 0.00000000000003 | 84 | 196 | 22 | 134 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_B | 0.00000000000003 | 84 | 196 | 22 | 134 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_A | 0.00000000000003 | 84 | 196 | 22 | 134 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 2xj6_A | 0.0000000000001 | 96 | 196 | 35 | 134 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| Hydropathy |
|---|
 |