y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G057766_T01
FamilyGH18
Protein PropertiesLength: 287 Molecular Weight: 31285.2 Isoelectric Point: 4.8071
ChromosomeChromosome/Scaffold: 5 Start: 197564845 End: 197565921
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18342039.1e-21
  ILAFAIDYTPVNQHPTPAPTNGVFSPFWDTGNLSPAAVAAIKAAHPNVAVMAGLGGDSVQDIVKAVFTPTSIDSWVANAVTSLTGIINTYGLDGVDVDYE
  HFSRGADVNTFVECIGRLLTQLKKNMPWITTSIAPFEDPVVQKYYQPLWGKYSGVIDYVNFQFYGYGDNT
Full Sequence
Protein Sequence     Length: 287     Download
MTNGFLFREY IGAQFTGVQF SDVPINSKLA FNFILAFAID YTPVNQHPTP APTNGVFSPF    60
WDTGNLSPAA VAAIKAAHPN VAVMAGLGGD SVQDIVKAVF TPTSIDSWVA NAVTSLTGII    120
NTYGLDGVDV DYEHFSRGAD VNTFVECIGR LLTQLKKNMP WITTSIAPFE DPVVQKYYQP    180
LWGKYSGVID YVNFQFYGYG DNTDVATYVQ FYDQQSANYP GGKVLASFMT GNTTGLISPD    240
LGISAAKELQ RQNKLPGLFI WSADSSKRSS YGFKYEIEGQ QIIANH*                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00636Glyco_183.0e-597203114+
pfam00704Glyco_hydro_183.0e-6106219120+
cd00598GH18_chitinase-like4.0e-9100197104+
cd02871GH18_chitinase_D-like1.0e-9108212124+
cd06544GH18_narbonin4.0e-1046266262+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY78491.1012861288hypothetical protein OsI_33583 [Oryza sativa Indica Group]
RefSeqNP_001064608.1012861288Os10g0416800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131214.1012861286hypothetical protein LOC100192522 [Zea mays]
RefSeqNP_001148230.1012861286chitinase 1 [Zea mays]
RefSeqXP_002449257.1012861286hypothetical protein SORBIDRAFT_05g006880 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B062832273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A062832273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A1e-2862844288A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB1e6z_B0.000037119777213A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate
PDB1e6z_A0.000037119777213A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE17801727412740
CA278718241472870
EE02086025812580
ES29263825912590
DV47111327812760