y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G057930_T02
FamilyGT8
Protein PropertiesLength: 298 Molecular Weight: 32221.2 Isoelectric Point: 9.4026
ChromosomeChromosome/Scaffold: 2 Start: 23397831 End: 23399745
Descriptiongalacturonosyltransferase-like 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT8442644.1e-27
  IHIAMTLDGTYLRGSLAGVLSVLRHAACPESVAFHFVASSASPARRLASLRRALAAAFPTLPATVHRFDARLVRGKISSSVRRALDQPLNYARIYLADLL
  PRSVSRVLYLDSDLLVVDDVARLWATDLGPDAALAAPEWRSGGYTAKLEYWMEVQKQEARIYELGSLPPFLLVFAGEVKAVEHRWNQHGLGGDNVAGQCR
  QLHPGPVSLLHWSGKGKPWLR
Full Sequence
Protein Sequence     Length: 298     Download
MRVLAVFLLG AAFAAAAGGG GELPEFREAP AFRNGAACAD APTIHIAMTL DGTYLRGSLA    60
GVLSVLRHAA CPESVAFHFV ASSASPARRL ASLRRALAAA FPTLPATVHR FDARLVRGKI    120
SSSVRRALDQ PLNYARIYLA DLLPRSVSRV LYLDSDLLVV DDVARLWATD LGPDAALAAP    180
EWRSGGYTAK LEYWMEVQKQ EARIYELGSL PPFLLVFAGE VKAVEHRWNQ HGLGGDNVAG    240
QCRQLHPGPV SLLHWSGKGK PWLRLDAGRP CPLDALWMPY DLLRRRGARD DLLAAVS*      300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02910PLN029103.0e-718126585+
PLN02867PLN028675.0e-8182280100+
PLN02742PLN027423.0e-11181280101+
cd06429GT8_like_12.0e-20131265149+
pfam01501Glyco_transf_81.0e-2845266257+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR34301.1012971297unknown [Zea mays]
GenBankEEE61391.102429723316hypothetical protein OsJ_15564 [Oryza sativa Japonica Group]
RefSeqNP_001053393.102229721341Os04g0530900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001142255.1012971342hypothetical protein LOC100274424 [Zea mays]
RefSeqXP_002446838.1012971342hypothetical protein SORBIDRAFT_06g023460 [Sorghum bicolor]
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR819899226222470
DY375631300262800
DY287293314222800
EC8904882041222800
FC882915308232750