y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G059845_T01
FamilyGT47
Protein PropertiesLength: 419 Molecular Weight: 47159.3 Isoelectric Point: 6.7313
ChromosomeChromosome/Scaffold: 6 Start: 162559883 End: 162562784
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47513460
  RLKVYVYELPPKYNKNVVAKDSRCLSHMFATEIFMHRFLLASAVRTLNPDEADWFYTPVYTTCDLTPWGHPLTVKSPRMMRSAIQYVSKRWPYWNRTEGA
  DHFFVTPHDFGACFYFQEEKAIQRGVLPVLRRATLVQTFGQKNHVCLREGSITIPPYAPPHKIRAHIVPPETPRSIFVYFRGLFYDTANDPEGGYYARGA
  RASVWENFKNNALFDISTEHPPTYYEDMQRAIFCLCPLGWAPWSPRLVEAVVFGCIPVIIADDIVLPFADAIPWEEIAVFVPEDDVLRLDTILTSI
Full Sequence
Protein Sequence     Length: 419     Download
MGGTGSATAA QALALAALLL ACSGVAVVTA QDIERIQGSA GDVLEDDPVG RLKVYVYELP    60
PKYNKNVVAK DSRCLSHMFA TEIFMHRFLL ASAVRTLNPD EADWFYTPVY TTCDLTPWGH    120
PLTVKSPRMM RSAIQYVSKR WPYWNRTEGA DHFFVTPHDF GACFYFQEEK AIQRGVLPVL    180
RRATLVQTFG QKNHVCLREG SITIPPYAPP HKIRAHIVPP ETPRSIFVYF RGLFYDTAND    240
PEGGYYARGA RASVWENFKN NALFDISTEH PPTYYEDMQR AIFCLCPLGW APWSPRLVEA    300
VVFGCIPVII ADDIVLPFAD AIPWEEIAVF VPEDDVLRLD TILTSIPMDE ILRKQRLLAN    360
PSMKQAMLFP QPAEPRDAFH QVLNGLARKL PHPKDVFLKP GQKVLNWTEG AQDDLKPW*     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin1.0e-8251346304+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF87529.1014181418unknown [Zea mays]
GenBankACG31432.1034182419secondary cell wall-related glycosyltransferase family 47 [Zea mays]
GenBankACG36767.1034182417secondary cell wall-related glycosyltransferase family 47 [Zea mays]
RefSeqNP_001147714.1014181418secondary cell wall-related glycosyltransferase family 47 [Zea mays]
RefSeqXP_002440185.102241820416hypothetical protein SORBIDRAFT_09g027450 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
xylogalacturonan biosynthesisRXN-9589EC-2.4.2.41xylogalacturonan β-1,3-xylosyltransferase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO868810329643920
GO872051325623860
GO846508325954190
DV533149276222970
GO868810223944158.9