y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G060061_T01
FamilyGT14
Protein PropertiesLength: 211 Molecular Weight: 22690.1 Isoelectric Point: 9.0774
ChromosomeChromosome/Scaffold: 8 Start: 10809440 End: 10811959
DescriptionCore-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT14552045.60519e-45
  FAYLLAGGRGDGRKLLRLLLAVYHPRNRYLLHLSADAPASERAELAAAVARAAPAVRAFSNVDVVGRPTAGTPMGSSGLAATLRAAAAMLRLDAEWDWFI
  TLNAADYPLLTQDDLIHVFSSVPRHLNFIDHTSDIGWKEYVLSKHSNSEW
Full Sequence
Protein Sequence     Length: 211     Download
MGAADKWLLP LVSVSFVSLL LFLSALSGFS ASSALFARLP PPSYVRRGAA APPSFAYLLA    60
GGRGDGRKLL RLLLAVYHPR NRYLLHLSAD APASERAELA AAVARAAPAV RAFSNVDVVG    120
RPTAGTPMGS SGLAATLRAA AAMLRLDAEW DWFITLNAAD YPLLTQDDLI HVFSSVPRHL    180
NFIDHTSDIG WKEYVLSKHS NSEWYTVHCC *                                   240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02485Branch6.0e-1275193119+
PLN03183PLN031832.0e-2453193141+
Gene Ontology
GO TermDescription
GO:0008375acetylglucosaminyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB40033.1011931193putative xylosyltransferase I [Oryza sativa Japonica Group]
RefSeqNP_001152461.1011931193xylosyltransferase 1 [Zea mays]
RefSeqXP_002284096.102719327192PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311492.1011931187predicted protein [Populus trichocarpa]
RefSeqXP_002457471.1011931193hypothetical protein SORBIDRAFT_03g007750 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3otk_D0.000016917099193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_C0.000016917099193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_B0.000016917099193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_A0.000016917099193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2gam_D0.000026917099193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HX15272819311930
FL832031119751939.99967e-42
DR808081149451933e-36
DT941987155451993e-36
DR955604149451934e-36