CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G061230_T01
FamilyAA2
Protein PropertiesLength: 163 Molecular Weight: 16833.5 Isoelectric Point: 7.2183
ChromosomeChromosome/Scaffold: 4 Start: 13946719 End: 13948647
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2621473.6e-21
  GSADPTILPALIRLQFHDCFVRGCDGSVLIKGGGNNNNNAEVDNGKHQGLRGLEIIEGAKTQLEAQCPGVVSCADIVVLAARDAVA
Full Sequence
Protein Sequence     Length: 163     Download
MAGTTRCSIR GSNAPGLALP CLLLLLLLAG AGVSNGQLQV GFYSKSCPDA ESTVASVVRQ    60
SGSADPTILP ALIRLQFHDC FVRGCDGSVL IKGGGNNNNN AEVDNGKHQG LRGLEIIEGA    120
KTQLEAQCPG VVSCADIVVL AARDAVAFVR LRMMCVICHV DI* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like1.0e-652147105+
pfam00141peroxidase7.0e-315414896+
PLN03030PLN030305.0e-3739150112+
cd00693secretory_peroxidase2.0e-5637149113+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACM17538.103514924137peroxidase [Oryza australiensis]
GenBankACM17578.103514928140peroxidase [Oryza granulata]
GenBankACN28859.1011491149unknown [Zea mays]
GenBankEAY80329.103515426142hypothetical protein OsI_35499 [Oryza sativa Indica Group]
RefSeqXP_002449395.103414931145hypothetical protein SORBIDRAFT_05g009400 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A3e-28381452108A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B6e-25371461109A Chain A, Peanut Peroxidase
PDB1sch_A6e-25371461109A Chain A, Peanut Peroxidase
PDB1qo4_A1e-23371472111A Chain A, Peanut Peroxidase
PDB1pa2_A1e-23371472111A Chain A, Arabidopsis Thaliana Peroxidase A2
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
36
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE02801416311630
DV51478514811480
EC88101014911490
DT65156214911490
EE02606014911490