y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G061833_T01
FamilyGT65
Protein PropertiesLength: 605 Molecular Weight: 67203 Isoelectric Point: 9.5539
ChromosomeChromosome/Scaffold: 1 Start: 208192636 End: 208200349
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT651063830
  YLTARFLNRPLLMPSLSASLFYKEVDLLQPISFDKVFDFNKFNARCHGFGTGRRWTADRDLDQLQQSIGSNADDSEVIEIVGENPFLWPDHWPVKDYAKI
  FDCLVLVPEIETEVVKVISKIREAGQRARHEAGGSHSKQRRDSSTNPPVSYVAVHMRVEKDWMIHCKKWEQRSKSHEICSSKEEIIHKVSQITDLRRPVV
  VYLAVADSLLEDDSITSGWRVGMVAYEKKKLGVTDIYDRQPYLIKSAIDFEVCSRADVFVGNSFSTFSNLVVLSRTER
Full Sequence
Protein Sequence     Length: 605     Download
MEEKSMDKFA ALISSFRYPG PRASGLHAPL KDVKNTLSVR SILKAPEKGT FRHTAKKTVR    60
HREGEVSGRE EKSIESRKLI FTRAKQYAEE YDALERASKF YNGKTYLTAR FLNRPLLMPS    120
LSASLFYKEV DLLQPISFDK VFDFNKFNAR CHGFGTGRRW TADRDLDQLQ QSIGSNADDS    180
EVIEIVGENP FLWPDHWPVK DYAKIFDCLV LVPEIETEVV KVISKIREAG QRARHEAGGS    240
HSKQRRDSST NPPVSYVAVH MRVEKDWMIH CKKWEQRSKS HEICSSKEEI IHKVSQITDL    300
RRPVVVYLAV ADSLLEDDSI TSGWRVGMVA YEKKKLGVTD IYDRQPYLIK SAIDFEVCSR    360
ADVFVGNSFS TFSNLVVLSR TERLYNLGKA SLCGENIGLS SYAYNVMGDD GEPQRWMTDM    420
SDTSLQSRPQ CSKPPCKKDQ MLAISPGLEL KGASKFYNGK TNSVADAAQP AKGTADPVNP    480
SPKKCKGFLS FGFSWTKSWS RRGATSSSEN FGKTLSAALT GSAQGNNRGG GNEHQGCQDP    540
AAHCLHLHRR SNTPGVSASP SGPGALRPQL ISVQMQSVSV AGVEDVAEST ASVSPREKRR    600
RSLQ*                                                                660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11298O-FucT-20.007195373194+
cd11302O-FucT-10.005256380148+
cd11299O-FucT_plant0.0001206389204+
pfam10250O-FucT2.0e-20109381326+
cd11296O-FucT_like1.0e-23224383164+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28408.1010342687430unknown [Zea mays]
EMBLCAH40837.1010342786430protein-O-fucosyltransferase 1 [Oryza sativa]
EMBLCAH40838.1010742690429protein-O-fucosyltransferase 1 [Saccharum officinarum]
RefSeqNP_001147772.1010342687430protein-O-fucosyltransferase 1 [Zea mays]
RefSeqXP_002451612.1010342687430hypothetical protein SORBIDRAFT_04g004590 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8579222721554260
GO8602822651624260
HO2837332351834170
GO8915372541554080
FL9686362291553830