| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G062974_T02 |
| Family | GH19 |
| Protein Properties | Length: 225 Molecular Weight: 23585.7 Isoelectric Point: 7.874 |
| Chromosome | Chromosome/Scaffold: 8 Start: 88812713 End: 88813481 |
| Description | basic chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 105 | 223 | 2.20004e-42 |
| VASVVPRDLFERLLLHRNDAACPARGFYTYDAFLAAAAAFPAFGTTGGDEQRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQERNPPSDYCEPRP QWPCAPGKKYFGRGPIQIS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 225 Download |
| MTESMYVYKI PAVRALPGSK DQRMSTPGAP SLATTAAAVL CVLAAALAVT VASGQQCGQQ 60 AGGATCRDCL CCSRFGFCGD TSEYCGAGCQ SQCTGCGPRP AGPGVASVVP RDLFERLLLH 120 RNDAACPARG FYTYDAFLAA AAAFPAFGTT GGDEQRKREV AAFLGQTSHE TTGGWPTAPD 180 GPFSWGYCFK QERNPPSDYC EPRPQWPCAP GKKYFGRGPI QISL* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| smart00270 | ChtBD1 | 6.0e-7 | 65 | 93 | 29 | + Chitin binding domain. | ||
| pfam00187 | Chitin_bind_1 | 3.0e-7 | 65 | 93 | 29 | + Chitin recognition protein. | ||
| cd06921 | ChtBD1_GH19_hevein | 3.0e-7 | 65 | 93 | 29 | + Hevein or Type 1 chitin binding domain subfamily co-occuring with family 19 glycosyl hydrolases or with barwin domains. This subfamily includes Hevein, a major IgE-binding allergen in natural rubber latex. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. | ||
| cd00325 | chitinase_glyco_hydro_19 | 5.0e-53 | 109 | 223 | 115 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| pfam00182 | Glyco_hydro_19 | 6.0e-59 | 108 | 223 | 116 | + Chitinase class I. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0008061 | chitin binding |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF04453.1 | 0 | 38 | 224 | 5 | 197 | AF000964_1 chitinase [Poa pratensis] |
| GenBank | AAF04454.1 | 0 | 38 | 223 | 5 | 196 | AF000966_1 chitinase [Poa pratensis] |
| RefSeq | NP_001150560.1 | 0 | 24 | 224 | 1 | 201 | LOC100284192 [Zea mays] |
| Swiss-Prot | Q9FRV1 | 0 | 36 | 223 | 3 | 198 | CHIA_SECCE RecName: Full=Basic endochitinase A; AltName: Full=Rye seed chitinase-a; Short=RSC-a; Flags: Precursor |
| RefSeq | XP_002441062.1 | 0 | 56 | 224 | 79 | 245 | hypothetical protein SORBIDRAFT_09g019660 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3iwr_B | 0 | 55 | 224 | 2 | 177 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
| PDB | 3iwr_A | 0 | 55 | 224 | 2 | 177 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
| PDB | 2dkv_A | 0 | 55 | 224 | 2 | 177 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
| PDB | 3cql_B | 0 | 104 | 223 | 1 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| PDB | 3cql_A | 0 | 104 | 223 | 1 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
