y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G070913_T01
FamilyCE8
Protein PropertiesLength: 332 Molecular Weight: 35265.5 Isoelectric Point: 8.7194
ChromosomeChromosome/Scaffold: 8 Start: 146148062 End: 146149862
Descriptionpectinesterase 11
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8413230
  LVVDQSGKGDHRRIQDAIDAAPASNRSAGGRGSVVIRIKPGVYREKVVVDKPCITLVGATAASSTVVITWNESWVAADSPTVSVLASDFVAKRIAFQNTF
  GTSGPAVAVRVAGDRAAFYGCRFTSFQDTLLDDTGRHYYRGCYVQGGTDFVFGNGKALFDKCHLHSVSPAGGAFTAHRRSSESEDTGFSFVGCKLTGLGA
  GTSVLGRPWGPYSRVVFALSYMSGTVRPQGWDDWSDSSRQSRSRTAFYGQYQCYGEGSRTDGRVAWSHDLSQAEAAPFITKVW
Full Sequence
Protein Sequence     Length: 332     Download
MLLNGDSRRA AATAAALLAL AACFCAATGD GDMAGPRPLV LVVDQSGKGD HRRIQDAIDA    60
APASNRSAGG RGSVVIRIKP GVYREKVVVD KPCITLVGAT AASSTVVITW NESWVAADSP    120
TVSVLASDFV AKRIAFQNTF GTSGPAVAVR VAGDRAAFYG CRFTSFQDTL LDDTGRHYYR    180
GCYVQGGTDF VFGNGKALFD KCHLHSVSPA GGAFTAHRRS SESEDTGFSF VGCKLTGLGA    240
GTSVLGRPWG PYSRVVFALS YMSGTVRPQG WDDWSDSSRQ SRSRTAFYGQ YQCYGEGSRT    300
DGRVAWSHDL SQAEAAPFIT KVWVGGQEWL R*                                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02773PLN027733.0e-6440330312+
PLN02671PLN026717.0e-7040331309+
PLN02665PLN026653.0e-7734330311+
PLN02682PLN026821.0e-8639331315+
PLN02432PLN024329.0e-15829331305+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF05574.2023318325Os01g0634600 [Oryza sativa Japonica Group]
GenBankEEC71149.1023318330hypothetical protein OsI_02978 [Oryza sativa Indica Group]
RefSeqNP_001043660.10393314293Os01g0634600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002281308.101333136344PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002458207.10373319301hypothetical protein SORBIDRAFT_03g028930 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A9.94922e-44413319309A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A1.99965e-42423316305B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A2e-204232334361A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB1qjv_B9e-185232519335A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A9e-185232519335A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ5544002251073300
EB7042312091263310
EB160499233372650
BJ235223194462360
BM1404771831193010