CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G075470_T01
FamilyGH38
Protein PropertiesLength: 930 Molecular Weight: 106431 Isoelectric Point: 6.3573
ChromosomeChromosome/Scaffold: 9 Start: 1848054 End: 1851533
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3862523.09687e-43
  LYDFIKQMMEGNMWLNDTIGVIPKNSWSIDPFGYSSTMAYLLRRMGFRNMLIQRTHYEVKKELAMKKNLEYLWRQNWDIEETTDIFVHMMPFYSYDIPHT
  CGPEPAICCQFDFARMRGFSYESCPWRVDPVETNPDNVKERATKLLDQYRKKSTLYRTNTLLIPLGDDFRYVSMDEAEVQFRNYEKLFDYINSNPHLNAE
  VKFGTLEDYFSTLRDEAEKINYSRSGQLGSAELQGFPTLSGDFFTYA
Full Sequence
Protein Sequence     Length: 930     Download
MKFIDLYDFI KQMMEGNMWL NDTIGVIPKN SWSIDPFGYS STMAYLLRRM GFRNMLIQRT    60
HYEVKKELAM KKNLEYLWRQ NWDIEETTDI FVHMMPFYSY DIPHTCGPEP AICCQFDFAR    120
MRGFSYESCP WRVDPVETNP DNVKERATKL LDQYRKKSTL YRTNTLLIPL GDDFRYVSMD    180
EAEVQFRNYE KLFDYINSNP HLNAEVKFGT LEDYFSTLRD EAEKINYSRS GQLGSAELQG    240
FPTLSGDFFT YADRNQDYWS GYYVSRPFFK AVDRVLEQTL RASEILGSFV LGYCQKFQCA    300
KLPISFSHKL TAARRNLALF QHHDGVTGTA KDHVVVDYGT RMHTSLQDLQ LFMSRAIEVL    360
LGDFHDRSDP TLLSHFEPVQ ERSKYDVQPV HKVLLPHEGK AQSVVFFNPL EQTRDEIVMV    420
VVSSPDVSVI NSNGSCLPSQ LSPEWQFVSD EKISTGRHRL YWRASVPPLG LETYYVVTGQ    480
DCEKAIPAVV KTYTAAQEFP CPEPYECSKL EGKTVEMKNS NYTLSFDTCH GLLQTVTRHK    540
YGEQTVVGEE IGMYRSHGSG AYLFKPLGEA RSIVEEGGYF ILTEGPLVQE AHSLPKTEWP    600
KSPLSHSTRM YNCGDSIQDM LIEKEYHVDL VGHAFNDREL IVRYKTDIDN QRIFYSDLNG    660
FQTSRRQTYD KIPLQGNYYP MPSLAFLQDS HGNRFSVHSK QSLGAASLKN GWLEIMLDRR    720
LVQDDGRGLG QGVMDNKPMN VIFHLLMESN VSALPQTHSL LTLQPSLLSH RVGAHLNYPM    780
HAFMSKKPHE KSFKLVQQSF APLTASLPCD VHIVNLKVPQ PLRFSHTEAA EPRFAVLLHR    840
RGWDASYCKR GGLECTTVGE EPVNLFYMFK DLSAVNVKAT SLNLLYDDPE MLGYLQQIGD    900
VGQEGNVLIS PMEIQAYKLD LQPPSSQEE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk1.0e-548198192+
cd11667GH38N_Man2A24.0e-1057263257+
cd11666GH38N_Man2A11.0e-1127263257+
cd10809GH38N_AMII_GMII_SfManIII_like5.0e-1537263257+
PLN02701PLN0270107922918+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF19191.2079291091032Os06g0245700 [Oryza sativa Japonica Group]
GenBankEEC80313.10129292321150hypothetical protein OsI_22355 [Oryza sativa Indica Group]
GenBankEEE65435.10129291651083hypothetical protein OsJ_20797 [Oryza sativa Japonica Group]
RefSeqNP_001057277.10129292551173Os06g0245700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002438145.1079292621184hypothetical protein SORBIDRAFT_10g008770 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1hxk_A08840147951A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A08840147951A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A08840147951A Chain A, Golgi Alpha-Mannosidase Ii
PDB1ps3_A08840177981A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A08840177981A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB662086281433230
JG9046392846479300
FL714386262102710
JG9075722856249080
GT0371963045028050