y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G076157_T01
FamilyGH16
Protein PropertiesLength: 292 Molecular Weight: 33420.4 Isoelectric Point: 5.1513
ChromosomeChromosome/Scaffold: 10 Start: 69238466 End: 69239731
Descriptionxyloglucan endotransglucosylase/hydrolase 25
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16522131.5e-24
  QTVSLSLDRWTTSAFRSKSTYLFGRFDVDIKLVPRDSAGTVTTVYMVTEGPWQYHDEIDLEFLGNTTGEPYTLHTNIYARGKGDREMQYRLWFDPTEDFN
  TYSIIWNPHMILILVNGVPLRRMKNRMRDDTPFPLFQPMRLYASIWDADEWATQGGRIKTDW
Full Sequence
Protein Sequence     Length: 292     Download
MWQLSRAYRM ASFCLISLAA AAVSPATGDM ADTVDMMWGN TQVLYDSSSG RQTVSLSLDR    60
WTTSAFRSKS TYLFGRFDVD IKLVPRDSAG TVTTVYMVTE GPWQYHDEID LEFLGNTTGE    120
PYTLHTNIYA RGKGDREMQY RLWFDPTEDF NTYSIIWNPH MILILVNGVP LRRMKNRMRD    180
DTPFPLFQPM RLYASIWDAD EWATQGGRIK TDWSHGPFTA FFRNYTANAC VPYNRAWICG    240
QGSGDSSWFN QELDEEGQQK LSEVNGRNKI YDYCTDSRRF PSGYPPECGS Q*            300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase1.0e-2060224184+
cd02175GH16_lichenase2.0e-2154219177+
pfam00722Glyco_hydro_161.0e-6635215182+
PLN03161PLN031613.0e-7710288291+
cd02176GH16_XET1.0e-11937288255+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD05383.1032917290putative xyloglucan endotransglycosylase [Oryza sativa Japonica Group]
GenBankEAZ06129.10329184367hypothetical protein OsI_28363 [Oryza sativa Indica Group]
GenBankEAZ41994.10329184367hypothetical protein OsJ_26544 [Oryza sativa Japonica Group]
RefSeqNP_001061333.1041291400649Os08g0240500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002444084.1012911291hypothetical protein SORBIDRAFT_07g007460 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B04928834272A Chain A, Contribution Of Disulfide Bond Toward Thermostability In Hyperthermostable Endocellulase
PDB1un1_A04928834272A Chain A, Contribution Of Disulfide Bond Toward Thermostability In Hyperthermostable Endocellulase
PDB1umz_B04928834272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A04928834272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B2.8026e-453728827267A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ797185244492920
JG92767728352870
CJ785364244492920
HO06110328652880
EB446133285102900