y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G076584_T02
FamilyGH17
Protein PropertiesLength: 428 Molecular Weight: 46199 Isoelectric Point: 5.0395
ChromosomeChromosome/Scaffold: 2 Start: 57126483 End: 57129708
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17413570
  GINYGQIADNLPSPARVSYLVRSMQVSKVKLYDADPYVLSAFVDTDVEFVVGIGNENVSAMVEPAAARAWVERHVQPYLPGTRITCITVGNEVLKGNDSA
  LKASLLPAMQSVYQALTAVGLQGRVNVTTAHSLDIMGSTYPPSAGAFGPDAVPYLQPLLAFLSAARSPFLINCYPYFAYKADPGNVPLEYVLFQPDAAGV
  TDASTGLRYDNMLYAQVDSVYAAIQKLGHTDVDVKVSETGWPSRGDPDEAGATPEYARTYIGNLLQRIEMGQGTPMRPSAPVDVYVFALFNENLKPGPAS
  ERNYGLLYPDGTPVYDV
Full Sequence
Protein Sequence     Length: 428     Download
MAVAERFGTR WPPSRFFVAV LLVLLTDGGA AWKRAEGLSM GINYGQIADN LPSPARVSYL    60
VRSMQVSKVK LYDADPYVLS AFVDTDVEFV VGIGNENVSA MVEPAAARAW VERHVQPYLP    120
GTRITCITVG NEVLKGNDSA LKASLLPAMQ SVYQALTAVG LQGRVNVTTA HSLDIMGSTY    180
PPSAGAFGPD AVPYLQPLLA FLSAARSPFL INCYPYFAYK ADPGNVPLEY VLFQPDAAGV    240
TDASTGLRYD NMLYAQVDSV YAAIQKLGHT DVDVKVSETG WPSRGDPDEA GATPEYARTY    300
IGNLLQRIEM GQGTPMRPSA PVDVYVFALF NENLKPGPAS ERNYGLLYPD GTPVYDVGLR    360
GYLPPMDYSQ GTREVDLVLG LCTCTPPCLP IPIRLSHCSR TFGLLQGVRF FVFISLVAIV    420
SITLSLS*                                                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53091.0e-767350296+
pfam00332Glyco_hydro_171.0e-9941357318+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAD40655.2013751376OSJNBa0073L04.8 [Oryza sativa (japonica cultivar-group)]
EMBLCAH67163.1013821383H0717B12.10 [Oryza sativa (indica cultivar-group)]
GenBankEAZ30671.1013741375hypothetical protein OsJ_14727 [Oryza sativa Japonica Group]
RefSeqNP_001052739.1013821383Os04g0412300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002446413.1014271410hypothetical protein SORBIDRAFT_06g015590 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0403591312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0403592315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0403592315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0403592315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0403592315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
402424
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV50868425512550
CO4658522331113430
DT93969322512250
CO465852253463700.000001
CO465852164104250.000001