CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G077299_T01
FamilyGH51
Protein PropertiesLength: 695 Molecular Weight: 76548.4 Isoelectric Point: 5.5164
ChromosomeChromosome/Scaffold: 4 Start: 186274255 End: 186280328
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512136850
  LQNLASATVTVSGESNWIKVEQKLVAKGTNRTSRLQITTNKKGVVWFDQVSLMPEDTYKGHGFRTELISMILDLKPRFLRFPGGCFVEGGWLRNAFRWRE
  SIGPWEERPGHFGDVWHYWTDDGLGYYEFLQLAEDLGTEPIWVFNNGVSHNDEVDTVAIAPFVKDVLDSIEFARGSANSTWGSVRAAMGHPEPFPVKYVA
  IGNEDCGKKFYRGNYLKFYNAIRQAYPDIQMISNCDGSSTPLDHPADLYDFHVYNDSKTLFNMKSTFDRTSRSGPKAFVSEYAVWRGDAGRGSLLASLAE
  AAFLTGLEKNSDIVSMASYAPLFVNDNDQTWNPDAIVFNSWQHYGTPSYWMQTLFRESSGAMFHPTTISSSYSGSLAASAITWQDSENSFLRVKVINFGS
  DAVTLTISTSGLQASINALGSTATVLTSADVMDENSFSNPTKVVPVKSDLSNAAEQMQVTLAPRSFSSFDLAL
Full Sequence
Protein Sequence     Length: 695     Download
MPCTRRRGAR VFLRMVDACM HGRHAGPTRI DKWKRMGITS NDAAPRAVLL RFLFLLCIGC    60
KCLASEVEAT QTATLAVDAS PQLARKIPDT LFGIFFEEIN HAGAGGIWAE LVSNRGFEAG    120
GLHTPSNIDP WSIIGDDSSV FVETDRTSCF SRNIVALRME VLCDNCPTGG VGVYNPGFWG    180
MNIEEGKVYN LVMFVKSPET TDLTVSLTSS NGLQNLASAT VTVSGESNWI KVEQKLVAKG    240
TNRTSRLQIT TNKKGVVWFD QVSLMPEDTY KGHGFRTELI SMILDLKPRF LRFPGGCFVE    300
GGWLRNAFRW RESIGPWEER PGHFGDVWHY WTDDGLGYYE FLQLAEDLGT EPIWVFNNGV    360
SHNDEVDTVA IAPFVKDVLD SIEFARGSAN STWGSVRAAM GHPEPFPVKY VAIGNEDCGK    420
KFYRGNYLKF YNAIRQAYPD IQMISNCDGS STPLDHPADL YDFHVYNDSK TLFNMKSTFD    480
RTSRSGPKAF VSEYAVWRGD AGRGSLLASL AEAAFLTGLE KNSDIVSMAS YAPLFVNDND    540
QTWNPDAIVF NSWQHYGTPS YWMQTLFRES SGAMFHPTTI SSSYSGSLAA SAITWQDSEN    600
SFLRVKVINF GSDAVTLTIS TSGLQASINA LGSTATVLTS ADVMDENSFS NPTKVVPVKS    660
DLSNAAEQMQ VTLAPRSFSS FDLALAQSKL VAEM* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06964Alpha-L-AF_C1.0e-31492677203+
COG3534AbfA5.0e-35274679482+
smart00813Alpha-L-AF_C2.0e-46492677198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27961.105269414656unknown [Zea mays]
GenBankACN33779.10156941680unknown [Zea mays]
GenBankEEC67598.105969421658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
RefSeqNP_001148977.10156941680alpha-N-arabinofuranosidase A [Zea mays]
RefSeqXP_002442705.105369415656hypothetical protein SORBIDRAFT_08g001540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L8e-2327468548483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K8e-2327468548483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J8e-2327468548483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I8e-2327468548483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H8e-2327468548483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0462043482596060
GO8018603291274550
GT0486153483196650
GT036166334613940
DR8227752922535440