| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G081160_T01 |
| Family | AA2 |
| Protein Properties | Length: 166 Molecular Weight: 17475.7 Isoelectric Point: 6.7954 |
| Chromosome | Chromosome/Scaffold: 1 Start: 197606142 End: 197610494 |
| Description | thylakoidal ascorbate peroxidase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 65 | 152 | 1.4e-22 |
| WHDAGTYDKNIIEWPKCSGANGSLRSKVELKHGANADLVNALKLIQPIKDKFSSVTYADLFQLARAIAIEEAGVPKIPMIYGRVDVIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 166 Download |
| MEVVEGAMAV AVAGGSTLTV VLPTILAAVE GTYRGGSGVG NDFSDQRQHY GGGNRGGGRG 60 DFQGWHDAGT YDKNIIEWPK CSGANGSLRS KVELKHGANA DLVNALKLIQ PIKDKFSSVT 120 YADLFQLARA IAIEEAGVPK IPMIYGRVDV IALDNARQRE GFLGQ* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 6.0e-16 | 65 | 149 | 90 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| pfam00141 | peroxidase | 4.0e-16 | 65 | 149 | 92 | + Peroxidase. | ||
| PLN02879 | PLN02879 | 3.0e-16 | 64 | 151 | 88 | + L-ascorbate peroxidase | ||
| PLN02608 | PLN02608 | 7.0e-24 | 65 | 163 | 99 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 7.0e-40 | 64 | 150 | 87 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN27920.1 | 0 | 64 | 156 | 71 | 163 | unknown [Zea mays] |
| GenBank | EEE52862.1 | 1.96182e-44 | 64 | 156 | 67 | 159 | hypothetical protein OsJ_35415 [Oryza sativa Japonica Group] |
| RefSeq | NP_001066305.1 | 1.96182e-44 | 64 | 156 | 67 | 159 | Os12g0178100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001132299.1 | 0 | 64 | 156 | 71 | 163 | hypothetical protein LOC100193740 [Zea mays] |
| RefSeq | XP_002441920.1 | 1.4013e-45 | 64 | 156 | 71 | 163 | hypothetical protein SORBIDRAFT_08g004880 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1iyn_A | 1.99993e-41 | 64 | 151 | 32 | 119 | A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability |
| PDB | 1apx_D | 2e-16 | 65 | 149 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_C | 2e-16 | 65 | 149 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_B | 2e-16 | 65 | 149 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_A | 2e-16 | 65 | 149 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
