| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G081583_T01 |
| Family | GH35 |
| Protein Properties | Length: 140 Molecular Weight: 15381.9 Isoelectric Point: 9.3652 |
| Chromosome | Chromosome/Scaffold: 4 Start: 67797673 End: 67799288 |
| Description | beta-galactosidase 4 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH35 | 36 | 127 | 0 |
| VINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWNGHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 140 Download |
| MSGGAPLLAL LLLAAAAMIA PSPANAAVSY DHRAVVINGQ RRILISGSIH YPRSTPEMWP 60 GLLQKAKDGG LDVVQTYVFW NGHEPVRGQY YFGDRYDLVR FVKLAKQAGL YVHLRIGPYV 120 CAEWNFGWVF LLSFSPLSC* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02449 | Glyco_hydro_42 | 0.008 | 50 | 115 | 67 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
| COG1874 | LacA | 4.0e-15 | 28 | 124 | 99 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 2.0e-56 | 36 | 127 | 92 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 1.0e-63 | 28 | 127 | 100 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0004565 | beta-galactosidase activity |
| GO:0005975 | carbohydrate metabolic process |
| GO:0009341 | beta-galactosidase complex |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| Swiss-Prot | A2X2H7 | 0 | 25 | 127 | 35 | 137 | BGAL4_ORYSI RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor |
| GenBank | ACG30563.1 | 0 | 25 | 127 | 25 | 127 | beta-galactosidase precursor [Zea mays] |
| RefSeq | NP_001130532.1 | 0 | 25 | 127 | 25 | 127 | hypothetical protein LOC100191631 [Zea mays] |
| Swiss-Prot | Q6Z6K4 | 0 | 25 | 127 | 35 | 137 | BGAL4_ORYSJ RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor |
| RefSeq | XP_002437187.1 | 0 | 26 | 127 | 29 | 130 | hypothetical protein SORBIDRAFT_10g022620 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3thd_D | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_C | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_B | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_A | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thc_D | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
