y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G081583_T04
FamilyGH35
Protein PropertiesLength: 723 Molecular Weight: 78688.8 Isoelectric Point: 8.0715
ChromosomeChromosome/Scaffold: 4 Start: 67798315 End: 67802337
Descriptionbeta galactosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35363380
  VINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWNGHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFGGFPVWLKY
  VPGISFRTDNGPFKAAMQAFVEKIVSMMKSEGLFEWQGGPIILAQVENEYGPMESVMGAGAKPYANWAAKMAVATGAGVPWVMCKQDDAPDPVINTCNGF
  YCDYFSPNSNSKPTMWTEAWTGWFTAFGGAVPHRPVEDMAFAVARFIQKGGSFVNYYMYHGGTNFDRTSGGPFIATSYDYDAPIDEYGLLRQPKWGHLRD
  LHK
Full Sequence
Protein Sequence     Length: 723     Download
MSGGAPLLAL LLLAAAAMIA PSPANAAVSY DHRAVVINGQ RRILISGSIH YPRSTPEMWP    60
GLLQKAKDGG LDVVQTYVFW NGHEPVRGQY YFGDRYDLVR FVKLAKQAGL YVHLRIGPYV    120
CAEWNFGGFP VWLKYVPGIS FRTDNGPFKA AMQAFVEKIV SMMKSEGLFE WQGGPIILAQ    180
VENEYGPMES VMGAGAKPYA NWAAKMAVAT GAGVPWVMCK QDDAPDPVIN TCNGFYCDYF    240
SPNSNSKPTM WTEAWTGWFT AFGGAVPHRP VEDMAFAVAR FIQKGGSFVN YYMYHGGTNF    300
DRTSGGPFIA TSYDYDAPID EYGLLRQPKW GHLRDLHKAI KQAEPALVSG DPTIQSLGNY    360
EKAYVFKSSG GACAAFLSNY HTSAAARVVF NGRRYDLPAW SISVLPDCKA AVFNTATVSE    420
PSAPARMSPA GGFSWQSYSE ATNSLDGRAF TKDGLVEQLS MTWDKSDYLW YTTYVNINSN    480
EQFLKSGQWP QLTIYSAGHS LQVFVNGQSY GAVYGGYDSP KLTYSGYVKM WQGSNKISIL    540
SAAVGLPNQG THYETWNVGV LGPVTLSGLN EGKRDLSDQK WTYQIGLHGE SLGVQSVAGS    600
SSVEWGSAAG KQPLTWHKAY FSAPSGDAPV ALDMGSMGKG QAWVNGRHIG RYWSYKASSS    660
GCGGCSYAGT YSETKCQTGC GDVSQRYYHV PRSWLNPSGN LLVMLEEFGG DLSGVKLVTR    720
TA*                                                                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.00850186153+
COG1874LacA1.0e-2028330367+
pfam01301Glyco_hydro_351.0e-15736340320+
PLN03059PLN03059028721699+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG30563.102572225723beta-galactosidase precursor [Zea mays]
GenBankEAZ01416.103172127716hypothetical protein OsI_23450 [Oryza sativa Indica Group]
RefSeqNP_001057920.103172125714Os06g0573600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130532.102572225722hypothetical protein LOC100191631 [Zea mays]
RefSeqXP_002437187.102672129724hypothetical protein SORBIDRAFT_10g022620 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A9.80909e-453633616325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.005492654400547A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D7e-402835711359A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C7e-402835711359A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160701287210
HO780602657787210
HO7955525241186360
HO7955525228792e-35
HO79555251791292e-35