y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G088753_T02
FamilyGH13
Protein PropertiesLength: 752 Molecular Weight: 85364 Isoelectric Point: 6.5403
ChromosomeChromosome/Scaffold: 5 Start: 63318740 End: 63324803
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132075321.9e-27
  LPRIRANNYNTVQLMAVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQSTQESYFHAGDRGYHK
  LWDSRLFNYANWEVLRFLLSNLRYWLDEFMFDGFRFDGVTSMLYHHHGINVGFTGNYQEYFSLDTAVDAVVYMMLANHLMHKLLPEATVVAEDVSGMPVL
  CRPVDEGGVGFDYRLAMAIPDRWIDYLKNKDDSEWSMGEIAHTLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYTGMSDLQPASPTIDRGIALQ
  KMIHFITMALGGDGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 752     Download
MATAKGDVDH LPIYDLDPKL EIFKDHFRYR MKRFLEQKGS IEENEGSLES FSKGYLKFGI    60
NTNEDGTVYR EWAPAAQEAE LIGDFNDWNG ANHKMEKDKF GVWSIKIDHV KGKPAIPHNS    120
KVKFRFLHGG VWVDRIPALI RYATVDASKF GAPYDGVHWD PPASERYTFK HPRPSKPAAP    180
RIYEAHVGMS GEKPAVSTYR EFADNVLPRI RANNYNTVQL MAVMEHSYYA SFGYHVTNFF    240
AVSSRSGTPE DLKYLVDKAH SLGLRVLMDV VHSHASNNVT DGLNGYDVGQ STQESYFHAG    300
DRGYHKLWDS RLFNYANWEV LRFLLSNLRY WLDEFMFDGF RFDGVTSMLY HHHGINVGFT    360
GNYQEYFSLD TAVDAVVYMM LANHLMHKLL PEATVVAEDV SGMPVLCRPV DEGGVGFDYR    420
LAMAIPDRWI DYLKNKDDSE WSMGEIAHTL TNRRYTEKCI AYAESHDQSI VGDKTIAFLL    480
MDKEMYTGMS DLQPASPTID RGIALQKMIH FITMALGGDG YLNFMGNEFG HPEWIDFPRE    540
GNNWSYDKCR RQWSLVDTDH LRYKYMNAFD QAMNALDERF SFLSSSKQIV SDMNDEEKVI    600
VFERGDLVFV FNFHPKKTYE GYKVGCDLPG KYRVALDSDA LVFGGHGRVG HDVDHFTSPE    660
GVPGVPETNF NNRPNSFKVL SPPRTCVAYY RVDEAGAGRR LHAKAETGKT SPAESIDVKA    720
SRASSKEDKE ATAGGKKGWK FARQPSDQDT K*                                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029603.0e-62210893+
PLN03244PLN032441.0e-133114639528+
PLN02960PLN029606.0e-180114639527+
PLN02447PLN0244701695696+
cd11321AmyAc_bac_euk_BE0164571408+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD50279.20175173832seed starch branching enzyme [Sorghum bicolor]
GenBankAAO20100.10175173823starch branching enzyme I [Zea mays]
GenBankABQ15209.10175173823starch branching enzyme I [Zea mays]
DDBJBAA01854.10175172822branching enzyme-I precursor [Zea mays]
RefSeqNP_001105370.10175173823starch branching enzyme1 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A017511755A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3amk_A016941695A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B016941695A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A016941695A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D1.99993e-416664526577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO619167652977440
HO794536694136940
HO777638641666940
CX1091874483097520
HO4581234013006890