| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G099454_T01 |
| Family | GH19 |
| Protein Properties | Length: 153 Molecular Weight: 16498.5 Isoelectric Point: 8.3199 |
| Chromosome | Chromosome/Scaffold: 1 Start: 7406938 End: 7407881 |
| Description | basic chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 31 | 135 | 1e-34 |
| VWSIITRPMFQSMLSHRGDSGCQGAFYTYDAFIEAASKFPGFGTTGDEQTRRRELAAFFGQTSHETTGGWATAPGGPFAWGYCRVKEQNPTDPPYYGRGP IQLTQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 153 Download |
| MWTRALATVL FVAGAALLGV GVGGASAQQG VWSIITRPMF QSMLSHRGDS GCQGAFYTYD 60 AFIEAASKFP GFGTTGDEQT RRRELAAFFG QTSHETTGGW ATAPGGPFAW GYCRVKEQNP 120 TDPPYYGRGP IQLTQYDQQH KHSACAMYRS IC* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00325 | chitinase_glyco_hydro_19 | 5.0e-36 | 35 | 134 | 114 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| pfam00182 | Glyco_hydro_19 | 6.0e-38 | 34 | 134 | 116 | + Chitinase class I. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACG32844.1 | 0 | 28 | 135 | 27 | 134 | basic endochitinase C precursor [Zea mays] |
| GenBank | ACN25433.1 | 0 | 28 | 135 | 20 | 127 | unknown [Zea mays] |
| GenBank | ACN27592.1 | 0 | 1 | 135 | 1 | 135 | unknown [Zea mays] |
| RefSeq | NP_001148217.1 | 0 | 28 | 135 | 26 | 133 | basic endochitinase C [Zea mays] |
| RefSeq | XP_002468565.1 | 0 | 28 | 135 | 26 | 133 | hypothetical protein SORBIDRAFT_01g048140 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3cql_B | 3e-38 | 30 | 134 | 1 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| PDB | 3cql_A | 3e-38 | 30 | 134 | 1 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| PDB | 3w3e_B | 1e-34 | 31 | 135 | 3 | 120 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
| PDB | 3w3e_A | 1e-34 | 31 | 135 | 3 | 120 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
| PDB | 1dxj_A | 5e-34 | 31 | 135 | 2 | 119 | A Chain A, Structure Of The Chitinase From Jack Bean |
