y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G099454_T02
FamilyGH19
Protein PropertiesLength: 260 Molecular Weight: 27860.4 Isoelectric Point: 8.5468
ChromosomeChromosome/Scaffold: 1 Start: 7406938 End: 7408184
Descriptionbasic chitinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH19312510
  VWSIITRPMFQSMLSHRGDSGCQGAFYTYDAFIEAASKFPGFGTTGDEQTRRRELAAFFGQTSHETTGGWATAPGGPFAWGYCRVKEQNPTDPPYYGRGP
  IQLTHEYNYRLAGQALNLNLVGNPDLVASDPVVAFKTAIWFWMTPQSPKPSCHAVMTGAWTPSATDRAAGRLPGYGLTSNIINGGLECGKGQSTDGAKDR
  VGYYKRYCDMLRVGYGDNVPC
Full Sequence
Protein Sequence     Length: 260     Download
MWTRALATVL FVAGAALLGV GVGGASAQQG VWSIITRPMF QSMLSHRGDS GCQGAFYTYD    60
AFIEAASKFP GFGTTGDEQT RRRELAAFFG QTSHETTGGW ATAPGGPFAW GYCRVKEQNP    120
TDPPYYGRGP IQLTHEYNYR LAGQALNLNL VGNPDLVASD PVVAFKTAIW FWMTPQSPKP    180
SCHAVMTGAW TPSATDRAAG RLPGYGLTSN IINGGLECGK GQSTDGAKDR VGYYKRYCDM    240
LRVGYGDNVP CKDQKPYGG*                                                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3179COG31791.0e-712517450+
cd00442lysozyme_like1.0e-1012521288+
cd00325chitinase_glyco_hydro_195.0e-11135251231+
pfam00182Glyco_hydro_193.0e-11434251233+
Gene Ontology
GO TermDescription
GO:0004568chitinase activity
GO:0006032chitin catabolic process
GO:0016998cell wall macromolecule catabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG32844.102825927261basic endochitinase C precursor [Zea mays]
GenBankACN25433.102825920254unknown [Zea mays]
GenBankACN27592.1012591259unknown [Zea mays]
RefSeqNP_001148217.102825926257basic endochitinase C [Zea mays]
RefSeqXP_002468565.102825926257hypothetical protein SORBIDRAFT_01g048140 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cql_B0302581243A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3cql_A0302581243A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3w3e_B0312583242A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall
PDB3w3e_A0312583242A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall
PDB4dyg_B0312573243A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE04572326012600
EE03888126012600
EC87416426012600
BG837392230282570
DR812288233312600