y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G104829_T01
FamilyGT61
Protein PropertiesLength: 413 Molecular Weight: 44864.1 Isoelectric Point: 8.6075
ChromosomeChromosome/Scaffold: 3 Start: 26308320 End: 26310877
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT61182770
  CDLSGSRADVCDLTGDIRLNATASEFIVVDPAAADDGPTTAYEIRPYARKGDATSMGRVTAVTVRVRATADAAPRCTVTHAEPAVAFSVGGYTGNLFHDF
  TDVIVPLYGTAQRYRGDVRLVVTDAGSSSSWWLAKYDAVLRGLSRHPPLHLHLAKAAGEVHCFGHVVLGLRARRELMVEPDPDPDRGRPDGVGMADFARF
  LRRALSLPRDAPTRPAAASSDDRRKPRLLVVSRRGTRRLLNADAVARVAEEVGFEAVVSE
Full Sequence
Protein Sequence     Length: 413     Download
MTRAAAAASV KQQRQPLCDL SGSRADVCDL TGDIRLNATA SEFIVVDPAA ADDGPTTAYE    60
IRPYARKGDA TSMGRVTAVT VRVRATADAA PRCTVTHAEP AVAFSVGGYT GNLFHDFTDV    120
IVPLYGTAQR YRGDVRLVVT DAGSSSSWWL AKYDAVLRGL SRHPPLHLHL AKAAGEVHCF    180
GHVVLGLRAR RELMVEPDPD PDRGRPDGVG MADFARFLRR ALSLPRDAPT RPAAASSDDR    240
RKPRLLVVSR RGTRRLLNAD AVARVAEEVG FEAVVSELEV SRDAAGVGRL INSFDALVGV    300
HGAGLTNMVF LPPGATVVQI VPWGGLQWIA RMDFGDPADA MGLRYIQYEI AVHESSLADK    360
YPRDHEIFTN PTALHKKGFK FLRHTFLIGQ DITLDVDRFR VVLLQALRNL TE*           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44211.0e-723432291+
pfam04577DUF5632.0e-15239346114+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA96858.107410176582HGA6, putative, expressed [Oryza sativa (japonica cultivar-group)]
DDBJBAF03774.20144108390Os01g0118400 [Oryza sativa Japonica Group]
RefSeqNP_001066470.107410127518Os12g0238900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002455300.1012412230626hypothetical protein SORBIDRAFT_03g008020 [Sorghum bicolor]
RefSeqXP_002457480.101411142556hypothetical protein SORBIDRAFT_03g008010 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO862034319894070
GO8748753051094130
FL907078267172820
EB670898291973870
CB667417283913730