CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G105221_T01
FamilyGT61
Protein PropertiesLength: 530 Molecular Weight: 58498.8 Isoelectric Point: 9.1645
ChromosomeChromosome/Scaffold: 8 Start: 157618948 End: 157621644
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT611183840
  CDRSSVHTDVCFMAGDVRTDAASLSLLLFPPHQQAQNGTSSEEDKEERVRPYPRKWERFIMDKVPEVRLRVAAPRRPDGEREEEEHRCDVRHDAPLLVMS
  AGGYTGNLFHAFNDGFLPSWLTVQHLRRRVVLGVVSYNPWWAGMFGEVISGLSDHPVVDLLHGTRTHCFPGAIVGTRYHGILIVDPARLRDNKTIVDFHQ
  MLADAYEKPPRETARPAQQQDLRDAEQRRRRRPRLGIVSRKGTRVIENQAAVARLASSVGFDVDILE
Full Sequence
Protein Sequence     Length: 530     Download
MEASAKLPVV VPKGVGGMDN DDVAPAGGKK QAAAGRWGFV QFFFVLAVVF CVLLYAPRVL    60
VLSPYGYSID VGLFAPTPTT ATASSVPQRV AGGNAVALDL DNQVRSPCSS MRDHTICCDR    120
SSVHTDVCFM AGDVRTDAAS LSLLLFPPHQ QAQNGTSSEE DKEERVRPYP RKWERFIMDK    180
VPEVRLRVAA PRRPDGEREE EEHRCDVRHD APLLVMSAGG YTGNLFHAFN DGFLPSWLTV    240
QHLRRRVVLG VVSYNPWWAG MFGEVISGLS DHPVVDLLHG TRTHCFPGAI VGTRYHGILI    300
VDPARLRDNK TIVDFHQMLA DAYEKPPRET ARPAQQQDLR DAEQRRRRRP RLGIVSRKGT    360
RVIENQAAVA RLASSVGFDV DILETANGLP LSAWYASLRA CDALVGVHGA DLTKFLFLRP    420
GRASLTQIAP LGVSPIARED FGEPAARMGL AYEQYEVRAG ESSLARRYAP GDVVLTDPEA    480
AKRDKGGWNL VARVYLGGQN VTLDLARFRQ TLARMHAHAM RQRRRQERL* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44210.002355462113+
pfam04577DUF5631.0e-635442170+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY77282.103652320485hypothetical protein OsI_05257 [Oryza sativa Indica Group]
RefSeqNP_001045438.103652320485Os01g0956200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001142280.1015291529hypothetical protein LOC100274449 [Zea mays]
RefSeqNP_001147864.1015291521glycosyltransferase [Zea mays]
RefSeqXP_002459122.1015221519hypothetical protein SORBIDRAFT_03g046290 [Sorghum bicolor]
Transmembrane Domains
StartEnd
3961
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO456124295193090
DR96449225912590
EE03052823812380
EE02326923312330
DT94650723412340