y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G107754_T02
FamilyGT2
Protein PropertiesLength: 538 Molecular Weight: 60598.7 Isoelectric Point: 9.1502
ChromosomeChromosome/Scaffold: 3 Start: 204926638 End: 204933568
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2982617.4e-28
  VQIPMFNEGQVYRLSIGAACGMSWPSERLVIQVLDDSTNPAIRELVEVECARWARKGVRICYENRSNRNGYKAGAMREGLKKHYARDCEFVAIFDADFQP
  DSDFLRRTVPLLQRDPGVGLVQARWRYVNADECILTRIQEMSLNYHFAVEQEVGSACHAFFGFN
Full Sequence
Protein Sequence     Length: 538     Download
MGRLDGGLGA ATPPSFVRAA WQAVRWSVVV PALQLAVYIC AAMSLMLFLE RLYMAAVVTG    60
LWLRRRRRHR VAGDGQRVLD DDDDLEADAG RCCPMVLVQI PMFNEGQVYR LSIGAACGMS    120
WPSERLVIQV LDDSTNPAIR ELVEVECARW ARKGVRICYE NRSNRNGYKA GAMREGLKKH    180
YARDCEFVAI FDADFQPDSD FLRRTVPLLQ RDPGVGLVQA RWRYVNADEC ILTRIQEMSL    240
NYHFAVEQEV GSACHAFFGF NGTAGVWRVA ALADAGGWKE RTTVEDMDLA VRASLRGWRF    300
VYVGDLVVRN ELPSTFKAYR YQQHRWSCGP ANLFRKVLPE ILRSDRVSLG KKFHLLYAFF    360
FVRKVVAHLV TFLFYCVVIP ACVLVQGDVR LPKYVAMYVP ALITLLNAAC TPRSCHLLIF    420
WILFENVMSM HRSKAAIIGL LEASRANEWV VTDKLGSSKA AAAVVAKKKK QQLVRSRCCS    480
TRREMHVLEL AMGVCLLYCA VYDIVFFGRD HYYMYLLLQS AAAFIVGFGY VGTTTPS*      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06423CESA_like4.0e-3098286189+
COG1215COG12157.0e-3194452361+
cd06435CESA_NdvC_like2.0e-33127336210+
cd06421CESA_CelA_like3.0e-4294334243+
cd06437CESA_CaSu_A22.0e-12994330237+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABG34547.102153727529cellulose synthase-like A1 [Pinus taeda]
GenBankACR35695.1015371537unknown [Zea mays]
GenBankEEC85104.10205339531hypothetical protein OsI_32487 [Oryza sativa Indica Group]
Swiss-ProtQ6UDF001553718526CSLA1_CYATE RecName: Full=Mannan synthase 1; AltName: Full=CtManS
RefSeqXP_002459874.10135373527hypothetical protein SORBIDRAFT_02g012870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hg6_A7e-1994329140386B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
Transmembrane Domains
StartEnd
2749
365387
402424
485507
512534
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794866524175330
CF5116933231204420
EX3355903001424410
DV7026492901694580
DR9331662951494430