| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G118003_T04 |
| Family | GH1 |
| Protein Properties | Length: 113 Molecular Weight: 13171.9 Isoelectric Point: 9.1906 |
| Chromosome | Chromosome/Scaffold: 1 Start: 264798705 End: 264799819 |
| Description | beta glucosidase 43 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 111 | 0 |
| MYGCVNYLKEKYGNPTIYITENGMDQPGNLTRDQYLRDATRVRFYRSYIGQLKKAIDQGANVAGYFAWSLLDNFEWLAGYSSKFGIVYVDFNTLERHPKA SAYWFRDMLQK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 113 Download |
| MYGCVNYLKE KYGNPTIYIT ENGMDQPGNL TRDQYLRDAT RVRFYRSYIG QLKKAIDQGA 60 NVAGYFAWSL LDNFEWLAGY SSKFGIVYVD FNTLERHPKA SAYWFRDMLQ KH* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 1.0e-25 | 7 | 110 | 106 | + beta-glucosidase | ||
| COG2723 | BglB | 1.0e-28 | 5 | 108 | 105 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PRK13511 | PRK13511 | 1.0e-28 | 1 | 106 | 107 | + 6-phospho-beta-galactosidase; Provisional | ||
| TIGR03356 | BGL | 8.0e-39 | 7 | 105 | 99 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-41 | 5 | 112 | 109 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3F4V | 0 | 1 | 110 | 371 | 480 | A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA-Glucosidase |
| GenBank | ABF98424.1 | 0 | 1 | 110 | 290 | 399 | Glycosyl hydrolase family 1 protein, expressed [Oryza sativa (japonica cultivar-group)] |
| GenBank | ABR25480.1 | 0 | 1 | 110 | 54 | 163 | non-cyanogenic beta-glucosidase precursor [Oryza sativa Indica Group] |
| GenBank | EAY86111.1 | 0 | 1 | 110 | 417 | 526 | hypothetical protein OsI_07481 [Oryza sativa Indica Group] |
| RefSeq | NP_001142124.1 | 0 | 1 | 112 | 391 | 502 | hypothetical protein LOC100274288 [Zea mays] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f5l_B | 0 | 1 | 110 | 371 | 480 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3f5l_A | 0 | 1 | 110 | 371 | 480 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3f5k_B | 0 | 1 | 110 | 371 | 480 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3f5k_A | 0 | 1 | 110 | 371 | 480 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3f5j_B | 0 | 1 | 110 | 371 | 480 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
