y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G118579_T01
FamilyGH16
Protein PropertiesLength: 327 Molecular Weight: 36152.6 Isoelectric Point: 9.7671
ChromosomeChromosome/Scaffold: 4 Start: 169801823 End: 169803627
Descriptionxyloglucan endotransglucosylase/hydrolase 32
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16812401.4e-24
  STSGSGFKSRRAFRSGYFGASVKLQAGYTAGVITAFYLSNADAHPGFHDEVDMEFLGTTPGQPYTLQTNVYVLGSGDGGPGRVVGREVKFRLDWFDPTAD
  FHHYAILWSPTHIIFYVDDVPIRRYPRRSETFPRRPMWVYGSIWDASSWATDDGRYKADY
Full Sequence
Protein Sequence     Length: 327     Download
MAAAPPARHR HRHRHALLIF VVVTAAAAGA DAQHPPLPGF YPSKRYRARP FSRDFRTLWG    60
AQHQSVSGGG GGGGVTIWLD STSGSGFKSR RAFRSGYFGA SVKLQAGYTA GVITAFYLSN    120
ADAHPGFHDE VDMEFLGTTP GQPYTLQTNV YVLGSGDGGP GRVVGREVKF RLDWFDPTAD    180
FHHYAILWSP THIIFYVDDV PIRRYPRRSE TFPRRPMWVY GSIWDASSWA TDDGRYKADY    240
RYSPFVARFS GLLLRACSPR APPRCRAPSG GPTGGGGDAL SPQQEAAMRW VQRNHMVYNY    300
CLDPKRDHSL TPECIIHHAA AGDTYY*                                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase2.0e-1698247164+
cd00413Glyco_hydrolase_162.0e-2180235157+
PLN03161PLN031613.0e-5351314274+
pfam00722Glyco_hydro_164.0e-6151242193+
cd02176GH16_XET1.0e-10048314274+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABU93485.10163142291xyloglucan endotraglucosylase/hydrolase [Vigna angularis]
GenBankACU17768.10163142291unknown [Glycine max]
DDBJBAD22925.103631735310putative xyloglucan endo-transglycosylase [Oryza sativa Japonica Group]
RefSeqNP_001141552.1013261326hypothetical protein LOC100273667 [Zea mays]
RefSeqXP_002269285.10163142291PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2uwc_B0333141271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2uwc_A0333141271A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2uwa_C0303141274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB2uwa_B0303141274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
PDB2uwa_A0303141274A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase Isoform Nxg1
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR824504238172540
DV524856226172420
EB814171218172340
DT545336281353140
DW092473300173150