y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G119689_T01
FamilyGH32
Protein PropertiesLength: 594 Molecular Weight: 65764.9 Isoelectric Point: 9.6636
ChromosomeChromosome/Scaffold: 2 Start: 56806976 End: 56810257
Descriptioncell wall invertase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH32583820
  HFQPPKNWINDPNAPMYYKGWYHFFYQYNPKGAVWGNIVWAHSVSRDLINWVALEPALRPSIPGDRYGCWSGSATVLPDGGGPVIMYTGVDHPDINYQVQ
  NVAYPKNVSDPLLREWVKPSHNPVIVPEGGINATQFRDPTTAWRGPGPEQWRLLVGSAAGSSPRGVAYVYRSRDFRRWRRVRRPLHSAATGMWECPDFYP
  VSKGGAPRAGLETSVPPGPRVKHVLKNSLDLRRYDYYTVGTYHPRAERYVPDDPAGDEHRLRYDYGNFYASKTFYDPAKRRRILWGWANESDSAADDVAK
  GWAGIQAIPRTVWLDPSGKQLLQWP
Full Sequence
Protein Sequence     Length: 594     Download
MRALVVVSFA SACLLLLLQL AGASHVVYNY KDLEAEAAAA TDQVPPSIVN PLLRTGYHFQ    60
PPKNWINDPN APMYYKGWYH FFYQYNPKGA VWGNIVWAHS VSRDLINWVA LEPALRPSIP    120
GDRYGCWSGS ATVLPDGGGP VIMYTGVDHP DINYQVQNVA YPKNVSDPLL REWVKPSHNP    180
VIVPEGGINA TQFRDPTTAW RGPGPEQWRL LVGSAAGSSP RGVAYVYRSR DFRRWRRVRR    240
PLHSAATGMW ECPDFYPVSK GGAPRAGLET SVPPGPRVKH VLKNSLDLRR YDYYTVGTYH    300
PRAERYVPDD PAGDEHRLRY DYGNFYASKT FYDPAKRRRI LWGWANESDS AADDVAKGWA    360
GIQAIPRTVW LDPSGKQLLQ WPIEEVEALR EKSVTLKNRL IKAGHHVEVT GIQTAQADVE    420
VSFEVSPAAL AGAETLDPAL AYDAEKLCGV KRADVRGGVG PFGLWVLASA NRKERTAVFF    480
RVFKPAAGSD KPVVLMCTDP TKSSLNPNLY RPTFAGFVDT DISNGKISLR SLIDRSVVES    540
FGAGGKTCIL SRVYPSLAIG KDARLYVFNN GRAHVKVSRL TAWEMKKPVM NGA*          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01322scrB_fam6.0e-4354398360+
COG1621SacC4.0e-6429556546+
cd08996GH32_B_Fructosidase6.0e-8664385332+
pfam00251Glyco_hydro_32N2.0e-14058382333+
smart00640Glyco_32058545496+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD02510.1015931593cell wall invertase Incw2 [Zea mays]
GenBankAAF06991.1015931592AF165179_1 cell wall invertase 2 [Zea mays]
GenBankAAF06992.1015931592AF165180_1 cell wall invertase 2 [Zea mays]
GenBankACG47298.1015931594beta-fructofuranosidase, insoluble isoenzyme 2 precursor [Zea mays]
RefSeqNP_001105596.1015931593miniature seed1 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2ac1_A0495854535A Chain A, Crystal Structure Of A Cell-Wall Invertase From Arabidopsis Thaliana
PDB2xqr_K0505851531B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB2xqr_I0505851531B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB2xqr_G0505851531B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB2xqr_E0505851531B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT842376570255940
DV8577723102775830
CD4391542631794410
CX6119072413565940
DR8177482092484560