y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G120362_T01
FamilyAA7
Protein PropertiesLength: 528 Molecular Weight: 56336 Isoelectric Point: 9.2643
ChromosomeChromosome/Scaffold: 7 Start: 167324318 End: 167326017
DescriptionFAD-binding Berberine family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7803260
  RKPEAVVLPTSRRGLQRAVLCARSASLAIRVRSGGHSYEGQSYTVSGGVLDGKAPFVVIDLMNLNKVRVHAASATAWAESGATLGEVYHAVAHSSPSNRS
  SLALTAASCSTIGLGGHISGGGFGPVSRKFMLAADNVLDALLVDAVGRVLDRRAMGEDVFWAIRGGGGGSWGVVYAWKLRLVPVPDTVTVFTPRREGSVD
  AMAGLVYRWQFVGPALPDEFYLSASLTIGSSSSSSQEDRDLRNVAFT
Full Sequence
Protein Sequence     Length: 528     Download
MYTNSSPTSL LLGILSILLS THRHVIASQS PRDNGVRARS LSTCLLASGV RNFSMAGSPG    60
YATIFDFSIQ NLRFAAPGFR KPEAVVLPTS RRGLQRAVLC ARSASLAIRV RSGGHSYEGQ    120
SYTVSGGVLD GKAPFVVIDL MNLNKVRVHA ASATAWAESG ATLGEVYHAV AHSSPSNRSS    180
LALTAASCST IGLGGHISGG GFGPVSRKFM LAADNVLDAL LVDAVGRVLD RRAMGEDVFW    240
AIRGGGGGSW GVVYAWKLRL VPVPDTVTVF TPRREGSVDA MAGLVYRWQF VGPALPDEFY    300
LSASLTIGSS SSSSQEDRDL RNVAFTGLVL GPKEMAMSVL NERFPELGLA EAEVSEMSWV    360
ESAARLAGLS SVDELTSRVS KTKYYGKNKS DYVQRPISRD SLAAILRYLS DGPPAGYVTM    420
DPYGGAMARL SATATPFPHR AGNLYALQYG VTWDSDAGEA SVNYIDIDLM GFDESLGPVR    480
LASSVSHARA TWGAAYFTVE NFDRLVRAKT LPMSFTMPKA YHCISGR*                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0277GlcD3.0e-68014970+
pfam01565FAD_binding_43.0e-98214766+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD03275.103851128531putative berberine bridge enzyme [Oryza sativa Japonica Group]
DDBJBAF23509.203851132535Os08g0343600 [Oryza sativa Japonica Group]
GenBankEAZ05659.10145109511hypothetical protein OsI_27886 [Oryza sativa Indica Group]
RefSeqNP_001061595.103351131539Os08g0343600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002445086.104051138543hypothetical protein SORBIDRAFT_07g003920 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fw9_A0415112478A Chain A, Structure Of Berberine Bridge Enzyme In Complex With (S)-Scoulerine
PDB4ec3_A0395116484A Chain A, Structure Of Berberine Bridge Enzyme, H174a Variant In Complex With (S)-Reticuline
PDB3gsy_A0395116484A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB3d2j_A04151127503A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB3d2h_A04151127503A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA7550542032494510
ES4343782232344560
EG3807031973425100
EC892424222392600
EL4517132662745102.8026e-45