| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G122708_T01 |
| Family | GH19 |
| Protein Properties | Length: 195 Molecular Weight: 20929.3 Isoelectric Point: 8.0482 |
| Chromosome | Chromosome/Scaffold: 2 Start: 33558850 End: 33559772 |
| Description | homolog of carrot EP3-3 chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 1 | 194 | 0 |
| FFDGIRSHARDGCEGKNFYTRSAFVSAAGAFPGFAHGGTEADGKREIAAFFAHVTFETGYFCYINQINGRGQASCDSGVKQWPCAPGKQYYGRGPLQISW NFNYGPAGQSIGFDALGDPDRVAQDPVISFKTALWLWMSSAHQVVPQGFGATIRALHGALECNGNSPATVNARVGYYKEYCKQFGVGPGNNLTC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 195 Download |
| FFDGIRSHAR DGCEGKNFYT RSAFVSAAGA FPGFAHGGTE ADGKREIAAF FAHVTFETGY 60 FCYINQINGR GQASCDSGVK QWPCAPGKQY YGRGPLQISW NFNYGPAGQS IGFDALGDPD 120 RVAQDPVISF KTALWLWMSS AHQVVPQGFG ATIRALHGAL ECNGNSPATV NARVGYYKEY 180 CKQFGVGPGN NLTC* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3179 | COG3179 | 0.0006 | 87 | 137 | 51 | + Predicted chitinase [General function prediction only] | ||
| cd00442 | lysozyme_like | 1.0e-9 | 83 | 138 | 56 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| pfam00182 | Glyco_hydro_19 | 4.0e-83 | 1 | 194 | 227 | + Chitinase class I. | ||
| cd00325 | chitinase_glyco_hydro_19 | 2.0e-87 | 1 | 194 | 226 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAT40049.1 | 0 | 1 | 194 | 85 | 277 | chitinase [Zea mays subsp. parviglumis] |
| GenBank | ACN35751.1 | 0 | 1 | 194 | 88 | 282 | unknown [Zea mays] |
| RefSeq | NP_001148209.1 | 0 | 1 | 194 | 40 | 233 | endochitinase A [Zea mays] |
| RefSeq | XP_002448104.1 | 0 | 1 | 194 | 40 | 232 | hypothetical protein SORBIDRAFT_06g021210 [Sorghum bicolor] |
| RefSeq | XP_002448105.1 | 0 | 1 | 194 | 78 | 271 | hypothetical protein SORBIDRAFT_06g021220 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hbh_A | 0 | 1 | 194 | 10 | 204 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3hbe_X | 0 | 1 | 194 | 10 | 204 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3hbd_A | 0 | 1 | 194 | 10 | 204 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
| PDB | 4dyg_B | 0 | 2 | 194 | 12 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
| PDB | 4dyg_A | 0 | 2 | 194 | 12 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
| Hydropathy |
|---|
 |