y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G125241_T03
FamilyCBM43
Protein PropertiesLength: 119 Molecular Weight: 11847 Isoelectric Point: 3.9713
ChromosomeChromosome/Scaffold: 1 Start: 73966249 End: 73968225
Descriptionplasmodesmata callose-binding protein 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43271075.7e-30
  CVCRSDQPTAVLQKAIDFACGPQGGADCTPILQGGGCYSPDTAAAHCSWAANTYYQNNKARGATCDFGGAATVSTTDPSTN
Full Sequence
Protein Sequence     Length: 119     Download
MEASSSALAL VAAVLLLSSP LAASDFCVCR SDQPTAVLQK AIDFACGPQG GADCTPILQG    60
GGCYSPDTAA AHCSWAANTY YQNNKARGAT CDFGGAATVS TTDPSTNDSS TTDTSIIS*     120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-16279877+
smart00768X82.0e-24269974+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR37837.1011161116unknown [Zea mays]
GenBankEAZ04609.14e-378107198hypothetical protein OsI_26758 [Oryza sativa Indica Group]
RefSeqNP_001147226.102110519103glucan endo-1,3-beta-glucosidase 4 [Zea mays]
RefSeqNP_001149846.1011051105LOC100283474 [Zea mays]
RefSeqXP_002465118.1011051105hypothetical protein SORBIDRAFT_01g032330 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A0.00000000000219105690A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL1906397525990
FL1906447525990
FL1906367525990
CO5301117525990
EE1533207525990