| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G125241_T03 |
| Family | CBM43 |
| Protein Properties | Length: 119 Molecular Weight: 11847 Isoelectric Point: 3.9713 |
| Chromosome | Chromosome/Scaffold: 1 Start: 73966249 End: 73968225 |
| Description | plasmodesmata callose-binding protein 3 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 27 | 107 | 5.7e-30 |
| CVCRSDQPTAVLQKAIDFACGPQGGADCTPILQGGGCYSPDTAAAHCSWAANTYYQNNKARGATCDFGGAATVSTTDPSTN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 119 Download |
| MEASSSALAL VAAVLLLSSP LAASDFCVCR SDQPTAVLQK AIDFACGPQG GADCTPILQG 60 GGCYSPDTAA AHCSWAANTY YQNNKARGAT CDFGGAATVS TTDPSTNDSS TTDTSIIS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-16 | 27 | 98 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-24 | 26 | 99 | 74 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACR37837.1 | 0 | 1 | 116 | 1 | 116 | unknown [Zea mays] |
| GenBank | EAZ04609.1 | 4e-37 | 8 | 107 | 1 | 98 | hypothetical protein OsI_26758 [Oryza sativa Indica Group] |
| RefSeq | NP_001147226.1 | 0 | 21 | 105 | 19 | 103 | glucan endo-1,3-beta-glucosidase 4 [Zea mays] |
| RefSeq | NP_001149846.1 | 0 | 1 | 105 | 1 | 105 | LOC100283474 [Zea mays] |
| RefSeq | XP_002465118.1 | 0 | 1 | 105 | 1 | 105 | hypothetical protein SORBIDRAFT_01g032330 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.000000000002 | 19 | 105 | 6 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
