y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G127184_T01
FamilyGT37
Protein PropertiesLength: 559 Molecular Weight: 61223.7 Isoelectric Point: 9.028
ChromosomeChromosome/Scaffold: 2 Start: 44434561 End: 44436541
Descriptionfucosyltransferase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT37735300
  TVPNPGDRLLGGLLSPDFDDSSCLSRYRASLYRRASLHALSPHLVSALRRYESLHRLCAPGTPAYARATERLRASPNASGDGADPSSSGARCNYLVWTPN
  AGLGNRILSIASGFLYALLTDRVLLLHSSSSHDLGDLFCEPFPGSTWILPEKDLPAVHEGLSTRTNASLGNTLRRGEALRGAPWLYVHLLHNYNVQDKLF
  FCDEVQAELRRVPWLVFQADNYFAPGLFLVPRHERELARMFPRRDAVFHHLGRYLFHPSNAVWGMVTRYHGSYFARADERVGVQVRVFKWAPISTDQFYA
  QILKCAEHENILPGVSVPRANTTAAAVGSAAQPAKRKAVVVVSLYNEYSEKLSELYHEHGAAGGEAVSVFQPTHLGEQRFGDRQQDQKALAEMVLLSFAD
  VLVTTGVSTFGYVSQGLAGLRPWVLMPPNHGKAPDTPCRLAPTIEPCFHSPPNYDCRA
Full Sequence
Protein Sequence     Length: 559     Download
MAARWQPGSK SRSSALRPTV LVAAASVAAV LLTAAVLFGA RWTPSSDAET WVSAGVRVVM    60
NAMSDKGGIP LATVPNPGDR LLGGLLSPDF DDSSCLSRYR ASLYRRASLH ALSPHLVSAL    120
RRYESLHRLC APGTPAYARA TERLRASPNA SGDGADPSSS GARCNYLVWT PNAGLGNRIL    180
SIASGFLYAL LTDRVLLLHS SSSHDLGDLF CEPFPGSTWI LPEKDLPAVH EGLSTRTNAS    240
LGNTLRRGEA LRGAPWLYVH LLHNYNVQDK LFFCDEVQAE LRRVPWLVFQ ADNYFAPGLF    300
LVPRHERELA RMFPRRDAVF HHLGRYLFHP SNAVWGMVTR YHGSYFARAD ERVGVQVRVF    360
KWAPISTDQF YAQILKCAEH ENILPGVSVP RANTTAAAVG SAAQPAKRKA VVVVSLYNEY    420
SEKLSELYHE HGAAGGEAVS VFQPTHLGEQ RFGDRQQDQK ALAEMVLLSF ADVLVTTGVS    480
TFGYVSQGLA GLRPWVLMPP NHGKAPDTPC RLAPTIEPCF HSPPNYDCRA KARGDTGRMV    540
RHIRHCEDFP QGVQLLQS*                                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.00216719428+
pfam03254XG_FTase061530476+
Gene Ontology
GO TermDescription
GO:0008107galactoside 2-alpha-L-fucosyltransferase activity
GO:0016020membrane
GO:0042546cell wall biogenesis
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAD40865.205055765580OSJNBa0064H22.18 [Oryza sativa (japonica cultivar-group)]
GenBankEAY94321.105055765580hypothetical protein OsI_16088 [Oryza sativa Indica Group]
RefSeqNP_001052928.105055771586Os04g0449100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001052929.105055767582Os04g0449200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002447927.105255762583hypothetical protein SORBIDRAFT_06g018250 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV2884053002325290
CJ6925772372594920
GT0436383111734820
DT7518202722865570
DT751820322542850.07