Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G131262_T05 |
Family | CBM43 |
Protein Properties | Length: 105 Molecular Weight: 10995.1 Isoelectric Point: 6.8801 |
Chromosome | Chromosome/Scaffold: 7 Start: 163670331 End: 163671885 |
Description | plasmodesmata callose-binding protein 3 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 17 | 95 | 1e-32 |
WCVCRQDASQAALQKTIDYACGSGADCNSIHETGACYNPNTVAAHCSWAANSYYQNNKAKGATCDFTGTAALTTSDPSK |
Full Sequence |
---|
Protein Sequence Length: 105 Download |
NAAHTLHNQT FFFGAEWCVC RQDASQAALQ KTIDYACGSG ADCNSIHETG ACYNPNTVAA 60 HCSWAANSYY QNNKAKGATC DFTGTAALTT SDPSKRAPST PLLA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-19 | 17 | 86 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-32 | 17 | 94 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF83296.1 | 0 | 16 | 101 | 20 | 105 | unknown [Zea mays] |
GenBank | ACG32291.1 | 0 | 16 | 101 | 21 | 106 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
GenBank | ACG46419.1 | 0 | 16 | 101 | 20 | 105 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
GenBank | ACN36886.1 | 0 | 16 | 104 | 20 | 108 | unknown [Zea mays] |
RefSeq | NP_001148400.1 | 0 | 16 | 101 | 20 | 105 | glucan endo-1,3-beta-glucosidase 3 [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-17 | 15 | 97 | 11 | 93 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |