| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G131262_T05 |
| Family | CBM43 |
| Protein Properties | Length: 105 Molecular Weight: 10995.1 Isoelectric Point: 6.8801 |
| Chromosome | Chromosome/Scaffold: 7 Start: 163670331 End: 163671885 |
| Description | plasmodesmata callose-binding protein 3 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 17 | 95 | 1e-32 |
| WCVCRQDASQAALQKTIDYACGSGADCNSIHETGACYNPNTVAAHCSWAANSYYQNNKAKGATCDFTGTAALTTSDPSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 105 Download |
| NAAHTLHNQT FFFGAEWCVC RQDASQAALQ KTIDYACGSG ADCNSIHETG ACYNPNTVAA 60 HCSWAANSYY QNNKAKGATC DFTGTAALTT SDPSKRAPST PLLA* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-19 | 17 | 86 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-32 | 17 | 94 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACF83296.1 | 0 | 16 | 101 | 20 | 105 | unknown [Zea mays] |
| GenBank | ACG32291.1 | 0 | 16 | 101 | 21 | 106 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
| GenBank | ACG46419.1 | 0 | 16 | 101 | 20 | 105 | glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays] |
| GenBank | ACN36886.1 | 0 | 16 | 104 | 20 | 108 | unknown [Zea mays] |
| RefSeq | NP_001148400.1 | 0 | 16 | 101 | 20 | 105 | glucan endo-1,3-beta-glucosidase 3 [Zea mays] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 7e-17 | 15 | 97 | 11 | 93 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |