y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G136139_T02
FamilyGH100
Protein PropertiesLength: 473 Molecular Weight: 52820.5 Isoelectric Point: 5.5254
ChromosomeChromosome/Scaffold: 4 Start: 163445823 End: 163448734
Descriptioncytosolic invertase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1001004700
  HPLIGEAWDALRRSMVSFRGQPLGTIAAVDHSSGEVLNYDQVFVRDFVPSALAFLMNGEPEIVRNFLLKTLLLQGWEKRIDRFKLGEGAMPASFKVLKDP
  KRGVDKLVADFGESAIGRVAPVDSGFWWIIILRAYTKSTGDMTLAETPMCQKGIRLIMNQCLAEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQALFFM
  ALRCALLMLKPDAEGKEIMERIVTRLTALSYHMRSYFWLDFQQLNDIYRFKTEEYSHTAVNKFNVNPESIPDWLFDFMPTRGGYFVGNVSPARMDFRWFA
  LGNCVAILASLATPDQAAAIMDLIEERWEDLVGEMPVKICYPAIEGHEWQIVTGCDPKNTRWSYHNGGSWP
Full Sequence
Protein Sequence     Length: 473     Download
MEAAPMRKAS SQASLADPDD FDLTRLLNHK PRINVDRQRS FDDRSLGEIS LAGAGTASRG    60
GWGYGGGGME SYESMYSPGG GLRSYCGTPA SSTRLSFEPH PLIGEAWDAL RRSMVSFRGQ    120
PLGTIAAVDH SSGEVLNYDQ VFVRDFVPSA LAFLMNGEPE IVRNFLLKTL LLQGWEKRID    180
RFKLGEGAMP ASFKVLKDPK RGVDKLVADF GESAIGRVAP VDSGFWWIII LRAYTKSTGD    240
MTLAETPMCQ KGIRLIMNQC LAEGFDTFPT LLCADGCCMI DRRMGVYGYP IEIQALFFMA    300
LRCALLMLKP DAEGKEIMER IVTRLTALSY HMRSYFWLDF QQLNDIYRFK TEEYSHTAVN    360
KFNVNPESIP DWLFDFMPTR GGYFVGNVSP ARMDFRWFAL GNCVAILASL ATPDQAAAIM    420
DLIEERWEDL VGEMPVKICY PAIEGHEWQI VTGCDPKNTR WSYHNGGSWP GQ*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02703PLN027033.0e-17973470403+
PLN03005PLN0300501470470+
PLN02973PLN0297306470466+
pfam12899Glyco_hydro_1000105470366+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001047095.1034707464Os02g0550600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001052830.1014701475Os04g0432400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147920.1014701470neutral/alkaline invertase [Zea mays]
RefSeqXP_002452632.1014702474hypothetical protein SORBIDRAFT_04g029440 [Sorghum bicolor]
RefSeqXP_002453965.1064709460hypothetical protein SORBIDRAFT_04g022350 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8100603091254330
DR9711182621263870
DT3358963031174190
DY262604307954010
DY262604823994710.022