y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G136158_T02
FamilyAA2
Protein PropertiesLength: 344 Molecular Weight: 35451 Isoelectric Point: 7.9824
ChromosomeChromosome/Scaffold: 8 Start: 3296569 End: 3298963
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2733240
  DPALPARLLRLHFHDCFVKGCDASILLDNAQSEKTAAPNLSVGGYEAIDAIKAQVEKACPGVVSCADIVALAARDAVSYQFGASLWQVETGRRDGGAPSL
  ASDALGALPSPFAGFGGLLAGFASRGLNLTDLVALSGAHTIGVASCSSVTPRLYQGNATSVDPLLDSAYARALMSSCPNPSPASATVGLDGGSPARFDSG
  FYARVRQGQGTLASDAALAQNAAAAQLMADLSTPASFYAAFSMSMKKMGRVD
Full Sequence
Protein Sequence     Length: 344     Download
MRGQTETGRW RGGDGVAAWW VAVVALQLGH SLSRARAGLL ESNPGLAYNF YQSSCPSAES    60
IVRSVTWAQV AADPALPARL LRLHFHDCFV KGCDASILLD NAQSEKTAAP NLSVGGYEAI    120
DAIKAQVEKA CPGVVSCADI VALAARDAVS YQFGASLWQV ETGRRDGGAP SLASDALGAL    180
PSPFAGFGGL LAGFASRGLN LTDLVALSGA HTIGVASCSS VTPRLYQGNA TSVDPLLDSA    240
YARALMSSCP NPSPASATVG LDGGSPARFD SGFYARVRQG QGTLASDAAL AQNAAAAQLM    300
ADLSTPASFY AAFSMSMKKM GRVDVLTGTN GQIRKQCRQI NTS*                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like1.0e-1084247177+
pfam00141peroxidase5.0e-4462213153+
PLN03030PLN030302.0e-6945341304+
cd00693secretory_peroxidase2.0e-12145340301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG24777.1013431346peroxidase 24 precursor [Zea mays]
RefSeqNP_001042703.103833823321Os01g0270300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147423.1013431346LOC100281032 [Zea mays]
RefSeqXP_002455434.1013431344hypothetical protein SORBIDRAFT_03g010740 [Sorghum bicolor]
RefSeqXP_002516845.104534127325Peroxidase 27 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0463412294A Chain A, Peanut Peroxidase
PDB1sch_A0463412294A Chain A, Peanut Peroxidase
PDB1qo4_A0503437306A Chain A, Peanut Peroxidase
PDB1pa2_A0503437306A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3hdl_A0463422304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Signal Peptide
Cleavage Site
37
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CD437482258262830
EE189595239903280
EE184585256893440
DR82082823712370
DR78494426612610