y
Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G136534_T02 |
Family | AA2 |
Protein Properties | Length: 160 Molecular Weight: 17527.9 Isoelectric Point: 6.5034 |
Chromosome | Chromosome/Scaffold: 1 Start: 194570791 End: 194572850 |
Description | Peroxidase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 3 | 142 | 2.3e-21 |
VKDLTPVFQRNGFTEVDMVALSGAHTVGFAHCSRFTDRLYSYGGARTDPSFNPAYAYQLKQACPIDVGPTIAVNMDPVSPIRFDNAYYANLQDGLGLFTS DQVLYADEATRPIVDMFAASQKDFFDAFVAAMLKLGRLGV |
Full Sequence |
---|
Protein Sequence Length: 160 Download |
MHVKDLTPVF QRNGFTEVDM VALSGAHTVG FAHCSRFTDR LYSYGGARTD PSFNPAYAYQ 60 LKQACPIDVG PTIAVNMDPV SPIRFDNAYY ANLQDGLGLF TSDQVLYADE ATRPIVDMFA 120 ASQKDFFDAF VAAMLKLGRL GVKTGKDGEI RRVCTAFNH* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02879 | PLN02879 | 1.0e-11 | 2 | 141 | 144 | + L-ascorbate peroxidase | ||
PLN02608 | PLN02608 | 2.0e-12 | 2 | 148 | 151 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 9.0e-19 | 2 | 143 | 151 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN03030 | PLN03030 | 2.0e-31 | 10 | 158 | 155 | + cationic peroxidase; Provisional | ||
cd00693 | secretory_peroxidase | 1.0e-77 | 3 | 157 | 156 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAD11654.1 | 0 | 1 | 159 | 174 | 333 | putative peroxidase [Oryza sativa Japonica Group] |
GenBank | EAZ09687.1 | 0 | 1 | 158 | 163 | 320 | hypothetical protein OsI_31969 [Oryza sativa Indica Group] |
RefSeq | NP_001062342.1 | 0 | 1 | 159 | 180 | 339 | Os08g0532700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001131174.1 | 0 | 1 | 159 | 99 | 257 | hypothetical protein LOC100192482 [Zea mays] |
RefSeq | XP_002444695.1 | 0 | 1 | 159 | 176 | 336 | hypothetical protein SORBIDRAFT_07g026130 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1bgp_A | 6e-34 | 18 | 158 | 170 | 305 | A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 |
PDB | 3hdl_A | 1e-31 | 2 | 158 | 144 | 303 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 1qo4_A | 4e-31 | 3 | 158 | 146 | 304 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 1pa2_A | 4e-31 | 3 | 158 | 146 | 304 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 3atj_B | 9e-28 | 19 | 158 | 163 | 306 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |