CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G138468_T01
FamilyGH13
Protein PropertiesLength: 440 Molecular Weight: 48269.2 Isoelectric Point: 6.2219
ChromosomeChromosome/Scaffold: 2 Start: 186265525 End: 186267387
Descriptionalpha-amylase-like
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13443486.20005e-41
  GGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDLDASKYGTHAELKSLTAAFHAKGVQCVADVVINHRCADYKDGRGIYCVFEGGTPDSR
  LDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDGWRLDFAKGYSAAVAKVYVDSTAPTFVVAEIWSSLHYDGNG
  EPSSNQDADRQELVNWAQAVGGPAAAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPSDKVMQGYAYILTHPGT
  PCIFY
Full Sequence
Protein Sequence     Length: 440     Download
MAKHLAAMCR CSLLVLVLLC LGSQLAQSQV LFQGFNWESW KKQGGWYNYL LGRVDDIAAT    60
GATHVWLPPP SHSVAPQGYM PGRLYDLDAS KYGTHAELKS LTAAFHAKGV QCVADVVINH    120
RCADYKDGRG IYCVFEGGTP DSRLDWGPDM ICSDDTQYSN GRGHRDTGAD FAAAPDIDHL    180
NPRVQQELSD WLNWLKSDLG FDGWRLDFAK GYSAAVAKVY VDSTAPTFVV AEIWSSLHYD    240
GNGEPSSNQD ADRQELVNWA QAVGGPAAAF DFTTKGVLQA AVQGELWRMK DGNGKAPGMI    300
GWLPEKAVTF VDNHDTGSTQ NSWPFPSDKV MQGYAYILTH PGTPCIFYDH VFDWNLKQEI    360
SALSAVRSRN GIHPGSELNI LAADGDLYVA KIDDKVIVKI GSRYDVGNLI PSDFHAVAHG    420
NNYCVWEKHG LRVPAGRHH* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09441PRK094413.0e-4227348386+
PLN02361PLN023616.0e-14029428405+
PLN02784PLN027845.0e-14229428401+
cd11314AmyAc_arch_bac_plant_AmyA4.0e-16030378352+
PLN00196PLN00196026428406+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004556alpha-amylase activity
GO:0005509calcium ion binding
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF88424.1014391439unknown [Zea mays]
GenBankEAZ09376.1014391437hypothetical protein OsI_31649 [Oryza sativa Indica Group]
RefSeqNP_001063369.1014391437Os09g0457800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105539.1014391439alpha-amylase [Zea mays]
RefSeqXP_002460331.1014391437hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bg9_A0294281402A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a
PDB1ava_B0294281402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1ava_A0294281402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1amy_A0294281402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB3bsg_A0294302406A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO1726942861554400
CX109008301263260
EE03417426812680
EE17569026612660
EE16865926432660