y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G138888_T02
FamilyGT30
Protein PropertiesLength: 153 Molecular Weight: 17157 Isoelectric Point: 11.2486
ChromosomeChromosome/Scaffold: 3 Start: 177535181 End: 177544703
DescriptionKDO transferase A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30431339.6e-25
  RWPERLGRPSAARPRPGSPLVWFHAVSLGEGMAALPIVRHCVRLRPGLPVLFTTTTLSSSEVIMDLLPDGVIYQIVLLDTGSQVWYFFWKV
Full Sequence
Protein Sequence     Length: 153     Download
MRPTRAASRG GWALYELYRT TSRVAAPAVL LWRRLQGLEH PTRWPERLGR PSAARPRPGS    60
PLVWFHAVSL GEGMAALPIV RHCVRLRPGL PVLFTTTTLS SSEVIMDLLP DGVIYQIVLL    120
DTGSQVWYFF WKVNSGQTSS CLQQQKGLQW LF*                                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N5.0e-164012687+
COG1519KdtA8.0e-1717132121+
PRK05749PRK057493.0e-1817132121+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0016740transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN31913.1011321134unknown [Zea mays]
GenBankACN31914.1011321134unknown [Zea mays]
GenBankACN36284.1011321134unknown [Zea mays]
RefSeqNP_001044852.1021345139Os01g0857300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002458792.1011321137hypothetical protein SORBIDRAFT_03g040370 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL32313214111410
FL36504215611460
DV17498913411320
DV174989331211530.0000000000005
FL365042331211532