CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G139355_T01
FamilyGT47
Protein PropertiesLength: 361 Molecular Weight: 40488.7 Isoelectric Point: 10.1443
ChromosomeChromosome/Scaffold: 1 Start: 212502284 End: 212503936
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471263410
  AALRVYMYDLPAEFHFGMLGWERKGKLAWPDVRDAHAAPHYPGGLNLQHSVAYWLTLDILSSALPPGSDVVRDRPCVAVRVTNASLANVFFVPFFASLSY
  NRHSKLRRGERVSRNRVLQAELVKYLMRKEEWRRWGGKNHLIVPHHPNSLMEARKKLSAAMFVLSDFGRYSPDVANLKKDVIAPYKHVLRSLGDGDSPSF
  EQRPILAYFQGAIHRK
Full Sequence
Protein Sequence     Length: 361     Download
MVVVERKMQP LPPPERRRVV RFVVFMAVSL LALFCWALVN SRINVAMPYS AFVMRDVDKT    60
PAFTGLEDRQ RHPAGDPAWT SAAPQAVPVT SNVTAGSVKL GDPVLREPLA GEAERERSER    120
CDADSAALRV YMYDLPAEFH FGMLGWERKG KLAWPDVRDA HAAPHYPGGL NLQHSVAYWL    180
TLDILSSALP PGSDVVRDRP CVAVRVTNAS LANVFFVPFF ASLSYNRHSK LRRGERVSRN    240
RVLQAELVKY LMRKEEWRRW GGKNHLIVPH HPNSLMEARK KLSAAMFVLS DFGRYSPDVA    300
NLKKDVIAPY KHVLRSLGDG DSPSFEQRPI LAYFQGAIHR KAVSPLFCSR DSLPGSFFEV    360

Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin1.0e-20128342220+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC83632.10234153395hypothetical protein OsI_29363 [Oryza sativa Indica Group]
RefSeqNP_001061895.10234153395Os08g0438600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002284930.1011734162281PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284932.10963415242PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002444408.1053498359hypothetical protein SORBIDRAFT_07g021480 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2039
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL472373219522700
FL7522001961493420
ES8258642231193410
DR942988257843400
BU996759183982750