y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G145461_T01
FamilyGH19
Protein PropertiesLength: 262 Molecular Weight: 27341.2 Isoelectric Point: 10.6112
ChromosomeChromosome/Scaffold: 6 Start: 82862563 End: 82863789
Descriptionbasic chitinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH19781344.4e-21
  VASIIPESLFNQMLLHRNDAACPANGFYTYAGFIAAANAFPGFGTTGAPDVQKRELA
Full Sequence
Protein Sequence     Length: 262     Download
MMRALAVVAM VATALFFAVP ARAEQCGSQA GGALCPNCLC CSQFGWCGST SDYCGSGCQS    60
QCSGSCGSTP NPPSSGGVAS IIPESLFNQM LLHRNDAACP ANGFYTYAGF IAAANAFPGF    120
GTTGAPDVQK RELAPGGVPG ADVARDDGRV GDGARRALRL GLLLQGGAGR RVGAGLLRAQ    180
RPVAVRRGEE VLRPRAHPDI LQLQLRARRP GHRRRHPRQP GPGGHRPHRV VRDRRLVLDD    240
AAVAQAVVPR RHDGAVDALR G*                                             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00270ChtBD13.0e-9255329+
pfam00187Chitin_bind_16.0e-12255329+
cd06921ChtBD1_GH19_hevein1.0e-12245330+
pfam00182Glyco_hydro_193.0e-238113454+
cd00325chitinase_glyco_hydro_191.0e-238213453+
Gene Ontology
GO TermDescription
GO:0004568chitinase activity
GO:0006032chitin catabolic process
GO:0008061chitin binding
GO:0016998cell wall macromolecule catabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT40012.1011341134chitinase [Zea mays subsp. parviglumis]
GenBankAAT40016.1011341134chitinase [Zea mays subsp. parviglumis]
GenBankACJ62110.1011341133chitinase [Zea mays subsp. parviglumis]
GenBankACJ62153.1011341134chitinase [Zea mays subsp. parviglumis]
RefSeqNP_001142232.1012611261hypothetical protein LOC100274400 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3iwr_B2e-33241342114A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB3iwr_A2e-33241342114A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB2dkv_A2e-33241342114A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica
PDB3cql_B1e-1877134158A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3cql_A1e-1877134158A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR80134126212620
EE17690826212620
EE04079920712070
EE01700326112610
FL135057188202070