Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G150683_T05 |
Family | CBM43 |
Protein Properties | Length: 90 Molecular Weight: 9232.15 Isoelectric Point: 6.1713 |
Chromosome | Chromosome/Scaffold: 7 Start: 167908806 End: 167915109 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 84 | 4.6e-32 |
CVAKQGADATALQAGLNWACGQGRANCAPIQPGGPCYKQNDLEALASYAYNDYYQKNFATGGSCGFNGTATTTTSDPSSGQC |
Full Sequence |
---|
Protein Sequence Length: 90 Download |
MFCVAKQGAD ATALQAGLNW ACGQGRANCA PIQPGGPCYK QNDLEALASY AYNDYYQKNF 60 ATGGSCGFNG TATTTTSDPS SGQCVFTGR* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-16 | 3 | 73 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-32 | 2 | 86 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACN26989.1 | 0 | 1 | 89 | 77 | 165 | unknown [Zea mays] |
GenBank | EEC75349.1 | 6.00036e-42 | 1 | 89 | 265 | 353 | hypothetical protein OsI_11774 [Oryza sativa Indica Group] |
RefSeq | NP_001060371.1 | 1.99993e-41 | 1 | 88 | 57 | 144 | Os07g0633100 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001150091.1 | 0 | 1 | 88 | 60 | 147 | LOC100283720 [Zea mays] |
RefSeq | XP_002463238.1 | 0 | 1 | 88 | 56 | 143 | hypothetical protein SORBIDRAFT_02g040340 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 8e-16 | 2 | 86 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |