CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G151122_T01
FamilyGH35
Protein PropertiesLength: 581 Molecular Weight: 65099.5 Isoelectric Point: 6.4627
ChromosomeChromosome/Scaffold: 2 Start: 196379519 End: 196383942
Descriptionbeta-galactosidase 14
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH352891.1e-28
  LWTENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMYKEPKFGHLRDLHN
Full Sequence
Protein Sequence     Length: 581     Download
MLWTENWTQQ FRAYGDQVAM RSAEDIAYAV LRFFAKGGSL VNYYMYHGGT NFGRTGASYV    60
LTGYYDEAPM DEYGMYKEPK FGHLRDLHNV IRSYQKAFLW GQHSSEILGH GYEAHIFELP    120
EEKLCLSFLS NNNTGEDGTV IFRGDKHYVP SRSVSILAGC KNVVYNTKRV FVQHSERSFH    180
TSDVTSKNNQ WEMFSETIPK YRDTKVRTKE PLEQYNQTKD DTDYLWYTTS FRLESDDLPF    240
RNDIRPVLQV KSSAHAMMGF ANDAFVGCAR GNKQVKGFMF EKPVDLKVGV NHVVLLSSTM    300
GMKDSGGELA EVKGGIQECL IQGLNTGTLD LQVNGWGHKA ALEGEYKEIY SEKGLGKVQW    360
KPAENDRAAT WYKRYFDEPD GDDPVVLDMS SMSKGMIFVN GEGVGRYWVS YRTLAGTPSQ    420
AVYHIPRPFL KSKDNLLVIF EEEMGKPDGI LVQTVTRDDI CLFISEHNPG QIKTWDTDGD    480
KIKLIAEDHS RRGTLTCPPE KTIQEVVFAS FGNPDGMCGN FTVGTCHTPN AKQIVEKECL    540
GKPSCMLPVD HTVYGADINC QSTTATLGVQ VRCGGGKKGA * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin8.0e-1849557382+
pfam01301Glyco_hydro_352.0e-2929194+
PLN03059PLN030591.0e-1322573600+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN33871.1015801580unknown [Zea mays]
GenBankEEC84965.102573228799hypothetical protein OsI_32205 [Oryza sativa Indica Group]
GenBankEEE70132.102573259830hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
Swiss-ProtQ0IZZ802571259828BGL12_ORYSJ RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: Precursor
RefSeqXP_002460584.101580258803hypothetical protein SORBIDRAFT_02g031260 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4e8d_B0.0006387443523572A Chain A, A Metazoan Ortholog Of Spot Hydrolyzes Ppgpp And Plays A Role In Starvation Responses
PDB4e8d_A0.0006387443523572A Chain A, A Metazoan Ortholog Of Spot Hydrolyzes Ppgpp And Plays A Role In Starvation Responses
PDB4e8c_B0.0006387443523572A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT94238225912590
DN2295212421994400
FL8292382431914330
AW0561562093565640
FL8142912291123400