y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G153200_T02
FamilyGH35
Protein PropertiesLength: 155 Molecular Weight: 16972.4 Isoelectric Point: 7.8147
ChromosomeChromosome/Scaffold: 3 Start: 173206829 End: 173209033
Descriptionbeta galactosidase 9
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35451371.4013e-45
  LILDGARRMLFSGDMHYPRSTPEMWPDLIAKAKKGGLDVIQTYVFWNAHEPVQGQFNFEGRYDLVKFIREIHAQGLYVSLRIGPFVESEWKYG
Full Sequence
Protein Sequence     Length: 155     Download
MTGAGVATVA MVVVAALAAA GRGAGGERGN TTAGRGEVTY DGRALILDGA RRMLFSGDMH    60
YPRSTPEMWP DLIAKAKKGG LDVIQTYVFW NAHEPVQGQF NFEGRYDLVK FIREIHAQGL    120
YVSLRIGPFV ESEWKYGYES MEYNITISII PRHS*                               180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_428.0e-66012567+
COG1874LacA2.0e-163813499+
PLN03059PLN030594.0e-4938137100+
pfam01301Glyco_hydro_351.0e-514413794+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACC64531.103713728128beta-galactosidase 6 [Oryza sativa Indica Group]
GenBankACC64532.103713728128beta-galactosidase 6 inactive isoform [Oryza sativa Indica Group]
GenBankEEC79266.103713724124hypothetical protein OsI_20049 [Oryza sativa Indica Group]
GenBankEEE63798.103713728128hypothetical protein OsJ_18622 [Oryza sativa Japonica Group]
Swiss-ProtQ75HQ303713728128BGAL7_ORYSJ RecName: Full=Beta-galactosidase 7; Short=Lactase 7; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D1e-19301373110A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_C1e-19301373110A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_B1e-19301373110A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_A1e-19301373110A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thc_D1e-19301373110A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
426
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK048087101371370
FL39536888371240
FL807930101371370
FL759331101371370
AW267917101371370