CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G154678_T01
FamilyGH9
Protein PropertiesLength: 529 Molecular Weight: 57787.7 Isoelectric Point: 6.7325
ChromosomeChromosome/Scaffold: 9 Start: 1328557 End: 1332136
Descriptionglycosyl hydrolase 9B8
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9575140
  DYEDALRKSLLYFEAQRSGRLPHGQRVTWRDHSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSLLEYGADVADAGELAHALESIKWGTDYF
  IKAHTRPDELWAEVGDGDTDHYCWQRPEDMTTSRQAYKVDRDRPGSDVAGETAAAMAAASMVFREHNPHYASLLLHHALQLFEFADKYRGKYDSSIAELL
  WAALWLHRATGRAEYLDYVVDNADDFGGTGWAITEFSWDVKYAGVQILAARLLLSGEHSPRHRETLEQYRAKAEHYVCACLGRNAADGNVERSPGGMLYV
  RQWNNMQYVTSAAFLLSAYSGYLSSSSSSSSVTCAAGGGSSAAASAGEVFALARAQVDYVLGSNPRGMSYLVGYGARFPARVHHRAASIVPYKHSKEFIG
  CAQGFDDWFVRKGANPNVVVGAIVGGPDRRDRFRDHRENYMQTEACTYNTAPMVGMFA
Full Sequence
Protein Sequence     Length: 529     Download
MKRTTSRSGA SPAAGLWLRP GRLGEVLAVA TLLASALLPS AAAATDAPPP ASSPRHDYED    60
ALRKSLLYFE AQRSGRLPHG QRVTWRDHSG LTDGLEQGVD LVGGYYDAGD HVKFGLPMAF    120
TVTMLSWSLL EYGADVADAG ELAHALESIK WGTDYFIKAH TRPDELWAEV GDGDTDHYCW    180
QRPEDMTTSR QAYKVDRDRP GSDVAGETAA AMAAASMVFR EHNPHYASLL LHHALQLFEF    240
ADKYRGKYDS SIAELLWAAL WLHRATGRAE YLDYVVDNAD DFGGTGWAIT EFSWDVKYAG    300
VQILAARLLL SGEHSPRHRE TLEQYRAKAE HYVCACLGRN AADGNVERSP GGMLYVRQWN    360
NMQYVTSAAF LLSAYSGYLS SSSSSSSVTC AAGGGSSAAA SAGEVFALAR AQVDYVLGSN    420
PRGMSYLVGY GARFPARVHH RAASIVPYKH SKEFIGCAQG FDDWFVRKGA NPNVVVGAIV    480
GGPDRRDRFR DHRENYMQTE ACTYNTAPMV GMFAMLNRLA RDEAGVNR* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00119PLN001193.0e-16957516473+
pfam00759Glyco_hydro_91.0e-17657514473+
PLN02420PLN02420057516474+
PLN02171PLN02171056527486+
PLN02340PLN02340057520478+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY87457.105652335514hypothetical protein OsI_08866 [Oryza sativa Indica Group]
RefSeqNP_001048062.105652357536Os02g0738600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151436.105652343522endoglucanase 1 [Zea mays]
Swiss-ProtQ6Z5P205652335514GUN7_ORYSJ RecName: Full=Endoglucanase 7; AltName: Full=Endo-1,4-beta glucanase 7; AltName: Full=OsGLU10; Flags: Precursor
RefSeqXP_002454315.105652365544hypothetical protein SORBIDRAFT_04g028520 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0565163429A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1ksc_A0565163429A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1ks8_A0565163429A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A04951918462B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0545162440B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
43
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY287831324573660
DY274365322573640
HO783495387614330
FC912705301573430
DY298364299573400