CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G172642_T01
FamilyAA1
Protein PropertiesLength: 590 Molecular Weight: 65395.2 Isoelectric Point: 5.3085
ChromosomeChromosome/Scaffold: 10 Start: 80314625 End: 80319134
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1395100
  QKVIAINNQFPGPLLNVTTNQNVRVNVQNNLDEPLLITWDGIQMRMNSWQDGVTGTNCPIPPGWNWTYEFQLKDQIGSFFYFPSLGLQRAAGGFGPITVN
  NRATVPVPFDQPHGDITLFIGDWYTKGHVELRNMLDDGQDLGAPDAILINGRAPYRYDSALVPDGLPYEIVGVEPGETYRFRVHNVGVSTSLNFRIQNHN
  MRLVETEGTYTNQQNYTDLDIHVGQSYSFLVTMDQNASTDYYIVASPRFVGNPRWHEVAGVAVLQYSNSKGRASGSLPDAPDDHYDKYHSMNQARSIRMN
  TSAGAARPNPQGSFHYGSINVTQTFVLKNEQPLSIGGKRRRTINRVSYSPPETPLRLADLHNLTGVYAADFPATPSDDDAPPRVASSALNASYKGFLEIV
  FQNNDTDVQTYHLDGYSFFVVGMDYGEWTPDRRSEYNKWDAISRCTTQVFPGGWTAVLVSLDNVGVWNLRAE
Full Sequence
Protein Sequence     Length: 590     Download
MAMAAAAVLA AVMAAAAAQA AEVRWEVAYL TVEPLGRPQK VIAINNQFPG PLLNVTTNQN    60
VRVNVQNNLD EPLLITWDGI QMRMNSWQDG VTGTNCPIPP GWNWTYEFQL KDQIGSFFYF    120
PSLGLQRAAG GFGPITVNNR ATVPVPFDQP HGDITLFIGD WYTKGHVELR NMLDDGQDLG    180
APDAILINGR APYRYDSALV PDGLPYEIVG VEPGETYRFR VHNVGVSTSL NFRIQNHNMR    240
LVETEGTYTN QQNYTDLDIH VGQSYSFLVT MDQNASTDYY IVASPRFVGN PRWHEVAGVA    300
VLQYSNSKGR ASGSLPDAPD DHYDKYHSMN QARSIRMNTS AGAARPNPQG SFHYGSINVT    360
QTFVLKNEQP LSIGGKRRRT INRVSYSPPE TPLRLADLHN LTGVYAADFP ATPSDDDAPP    420
RVASSALNAS YKGFLEIVFQ NNDTDVQTYH LDGYSFFVVG MDYGEWTPDR RSEYNKWDAI    480
SRCTTQVFPG GWTAVLVSLD NVGVWNLRAE RLDDWYRGQE VYVKVADPLG YNITEMVVPD    540
NALYCGLLKE RQKPQVHESN SKSSAQGDAG WSNRLLATMI LVVAAVIFS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02991PLN029918.0e-17325546523+
PLN00044PLN00044025586566+
PLN02354PLN02354025555533+
PLN02168PLN02168025546532+
PLN02835PLN02835025546523+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC55686.102258734598putative pectinesterase [Oryza sativa Japonica Group]
GenBankEEC82918.102258732574hypothetical protein OsI_27845 [Oryza sativa Indica Group]
GenBankEEE68063.102258734605hypothetical protein OsJ_26072 [Oryza sativa Japonica Group]
RefSeqNP_001151974.10135891577LOC100285611 [Zea mays]
RefSeqXP_002445068.102258923587hypothetical protein SORBIDRAFT_07g003590 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0185461539X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB1asq_A0185461539X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB1asp_B0185461539X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB1asp_A0185461539X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB1aso_B0185461539X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO796073546415860
EC889523280783570
EE176448271883580
EE175952270863550
EC900971280223010