y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G313184_T01
FamilyAA2
Protein PropertiesLength: 324 Molecular Weight: 34847.9 Isoelectric Point: 5.1397
ChromosomeChromosome/Scaffold: 6 Start: 3284341 End: 3285921
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2573040
  MKDPTLAGSLLRLHFHDCFVQGCDASVLIDSADGNTAEKDAQANLTLRGFEVIDRIKELLESQCPGVVSCADVLALAARDAVLLARGPYYGVPLGRRDGT
  RSVDSDTFTALPPAFFNVTMLMKLFGSHGFTVQDMVALSGGHTLGVAHCANFKGRLAETDTLDAALGSSLGATCTANGDAGVATFDRTSTSFDTVYFREL
  QMRRGLLSSDQTLFESPETRGIVNMFAMNQAYFFYAFQQGMLKMGQLD
Full Sequence
Protein Sequence     Length: 324     Download
MAKTTMSAAK NLVRLLVLVQ VSLGLLGGVA ALSFDYYGMT CPFAEMMVRS VVYDALMKDP    60
TLAGSLLRLH FHDCFVQGCD ASVLIDSADG NTAEKDAQAN LTLRGFEVID RIKELLESQC    120
PGVVSCADVL ALAARDAVLL ARGPYYGVPL GRRDGTRSVD SDTFTALPPA FFNVTMLMKL    180
FGSHGFTVQD MVALSGGHTL GVAHCANFKG RLAETDTLDA ALGSSLGATC TANGDAGVAT    240
FDRTSTSFDT VYFRELQMRR GLLSSDQTLF ESPETRGIVN MFAMNQAYFF YAFQQGMLKM    300
GQLDLKEGDD GEIRHTCRVI NSS*                                           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase5.0e-10151303164+
cd00314plant_peroxidase_like4.0e-1948302286+
pfam00141peroxidase4.0e-5848285239+
PLN03030PLN030306.0e-6636321300+
cd00693secretory_peroxidase1.0e-13934320296+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11766.101132113323class III peroxidase [Gossypium hirsutum]
EMBLCAH69359.10103212315TPA: class III peroxidase 117 precursor [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001060836.10103213316Os08g0113000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002443747.1013222319hypothetical protein SORBIDRAFT_07g001280 [Sorghum bicolor]
RefSeqXP_002518016.102632121315Peroxidase 47 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0323212294A Chain A, Peanut Peroxidase
PDB1sch_A0323212294A Chain A, Peanut Peroxidase
PDB1bgp_A0303217305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A0323233306A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1pa2_A0323233306A Chain A, Arabidopsis Thaliana Peroxidase A2
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CN125494212352460
HX129890259483050
BM326614194722650
FE629973233913220
DW004134295353210