CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G325561_T01
FamilyGT47
Protein PropertiesLength: 510 Molecular Weight: 57255.2 Isoelectric Point: 9.0008
ChromosomeChromosome/Scaffold: 9 Start: 14645426 End: 14647309
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471594600
  KLFRVYVYEEGEPPILHAGPCKNIYTIEGRFIEQLELMAPSPASSSRRGTRRRSASDVRTSEPARAHAFFLPFSVSQMVQFAYRPNTYDKTPLRAIVADY
  VRVVASRHPYWNRSAGADHFMLACHDWGPEASTGHPELHANGIRALCNANSSEGFRPWQDVSVPDINLYDGDMPRQLLAPAPGVTSRPFLAFFAGGRHGH
  IRDLLLRHWKGRDPDFFPVYEHRHEDGFDYYSFMRRARFCLCPSGYQVASPRVVESIHAECVPVILSDGYVLPFADVLRWEAFSVAVPVADIPRLREVLE
  RI
Full Sequence
Protein Sequence     Length: 510     Download
MAPECSRRDA PPSATLLIVC VALYTVVLAV ASSPKALASS SALSSRARAA PEQQLLLSAD    60
LTTRKETVKS LAKRSYVCQE ESARRPGETR RPPSVEQELD VARAAIRRTA QRHGDAGRAG    120
DGNVSSANTW FDAGVEYALL ASVYRNPAAF HRSYAEMEKL FRVYVYEEGE PPILHAGPCK    180
NIYTIEGRFI EQLELMAPSP ASSSRRGTRR RSASDVRTSE PARAHAFFLP FSVSQMVQFA    240
YRPNTYDKTP LRAIVADYVR VVASRHPYWN RSAGADHFML ACHDWGPEAS TGHPELHANG    300
IRALCNANSS EGFRPWQDVS VPDINLYDGD MPRQLLAPAP GVTSRPFLAF FAGGRHGHIR    360
DLLLRHWKGR DPDFFPVYEH RHEDGFDYYS FMRRARFCLC PSGYQVASPR VVESIHAECV    420
PVILSDGYVL PFADVLRWEA FSVAVPVADI PRLREVLERI PAPEVEKLQQ GVRLVKRHFM    480
LNQPPQRLDM FNMILHSVWL RRLNLRLDH* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin8.0e-63157460324+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD44815.109350864512putative pectin-glucuronyltransferase [Oryza sativa Japonica Group]
EMBLCAH67778.109450738439H0201G08.5 [Oryza sativa (indica cultivar-group)]
GenBankEEC80122.109350864543hypothetical protein OsI_21883 [Oryza sativa Indica Group]
RefSeqNP_001052025.1011950760439Os04g0109900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002437936.1015249952402hypothetical protein SORBIDRAFT_10g005120 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
xylogalacturonan biosynthesisRXN-9589EC-2.4.2.41xylogalacturonan β-1,3-xylosyltransferase
Transmembrane Domains
StartEnd
1332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE6794992352765100
GE4756052952185070
FE5233383151324460
DR9235592392695070
GW8648153251734970