y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G336929_T01
FamilyGT61
Protein PropertiesLength: 342 Molecular Weight: 37884.5 Isoelectric Point: 5.5626
ChromosomeChromosome/Scaffold: 3 Start: 26078264 End: 26081496
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT6112030
  MPDIKMVTVTQLEDKSSAPPCTVTYNIPAVLFALGGLTGNFWHDFGDVLVPLFIASRRYDGEVQFLISNMKPWWPAAYKTILQRLSKYDAVDLDGDGDGD
  AHVVRCFPHVTVGIHMHNGLSIVPEWAPGPPGGRGLTMADFTRFMREVYALPRDAPASLVREEPGKQSPPPRLLLIHREHSRRFMNEREILQAAEAAGFE
  AVA
Full Sequence
Protein Sequence     Length: 342     Download
MPDIKMVTVT QLEDKSSAPP CTVTYNIPAV LFALGGLTGN FWHDFGDVLV PLFIASRRYD    60
GEVQFLISNM KPWWPAAYKT ILQRLSKYDA VDLDGDGDGD AHVVRCFPHV TVGIHMHNGL    120
SIVPEWAPGP PGGRGLTMAD FTRFMREVYA LPRDAPASLV REEPGKQSPP PRLLLIHREH    180
SRRFMNEREI LQAAEAAGFE AVALDLRRDV TVDAQARVVN SFDVLLGVHG AGLTNSVFLP    240
PGAVLVQVVP YGKMDVIATL EFGLPAKEMG LKYLDYVVSA EESTLLEMLG PEHPAIKDPD    300
SIHRSGWDKM TEFYLNMQDV RIDVARFAPV LTQAFDHLRQ Q*                       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44210.00416425088+
pfam04577DUF5637.0e-12136255122+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAV65333.101341167505HGA1 [Hordeum vulgare]
GenBankACG44230.101341175503glycosyltransferase [Zea mays]
EMBLCAI30075.101341177516glycosyltransferase [Triticum aestivum]
RefSeqNP_001130300.101341176504hypothetical protein LOC100191394 [Zea mays]
RefSeqXP_002455294.103341140469hypothetical protein SORBIDRAFT_03g007950 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL817247253202720
CJ8458182181323420
GO86203433093360
GR5186422211223420
FL8055161991443420