y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G341934_T01
FamilyAA2
Protein PropertiesLength: 330 Molecular Weight: 33465.8 Isoelectric Point: 4.8514
ChromosomeChromosome/Scaffold: 1 Start: 4601116 End: 4604608
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2533110
  SGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAGNQAEKDAAPNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVPAGRRDGN
  VSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFAPRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVT
  PTAFDTNYYANLVARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAI
Full Sequence
Protein Sequence     Length: 330     Download
MVGRGAATAL VWAAVVAVAT VVSRAQQLQV GFYDTLCPAA EIIVQEEVSK AASGNPGVAA    60
GLLRLHFHDC FVRGCDASVL LDSSAGNQAE KDAAPNASLR GFEVIDSAKT RLEQACFGVV    120
SCADVLAFAA RDALALVGGD AYQVPAGRRD GNVSSAQEAG ANLPPPTASA SQLTQAFGAK    180
GLSQAEMVAL SGAHTVGAAR CSSFAPRLYS YGPSGAGQDP SMDPAYLAAL AQQCPPQGTG    240
AADPPLPMDP VTPTAFDTNY YANLVARRGL LASDQALLAD PATAAQVLAY TNSPATFQTD    300
FVAAMIKMGA IQVLTGTAGT VRTNCRVAS*                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000326329331+
cd00314plant_peroxidase_like5.0e-2644309297+
pfam00141peroxidase4.0e-6244196154+
PLN03030PLN030302.0e-8924325306+
cd00693secretory_peroxidase9.0e-16827327301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF82976.1013291303unknown [Zea mays]
GenBankACF83711.1013291329unknown [Zea mays]
GenBankACG35820.1013151315peroxidase 66 precursor [Zea mays]
RefSeqNP_001130801.106232910274hypothetical protein LOC100191905 [Zea mays]
RefSeqXP_002465968.102732933333hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0283292303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B0273261291A Chain A, Peanut Peroxidase
PDB1sch_A0273261291A Chain A, Peanut Peroxidase
PDB1qo4_A0273262301A Chain A, Peanut Peroxidase
PDB1pa2_A0273262301A Chain A, Arabidopsis Thaliana Peroxidase A2
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT941627248232700
DR80086625212520
DT94041124312430
DV02019224012400
DR80577123812380