y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G354610_T02
FamilyGT61
Protein PropertiesLength: 522 Molecular Weight: 58089.7 Isoelectric Point: 6.7394
ChromosomeChromosome/Scaffold: 9 Start: 51340492 End: 51342862
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT611473890
  ARPPVCELAGDIRVSPKEKTMYFVNPSGAGPFDSNGEKKIRPFARKDDFLLPGVVEVTIKSVSSAAAAPRCTRRHDVPVVVFSVAGYTDNFFHDNTDVLI
  PLFLTTAHLQGEVQLLVTNYKPWWVRKFTPLLRKLSNYDVIDFGKDDEVHCFRAGHLGMYRDRDLIISPHPTRNPRNYSMVDYNRFLRRAFNLPRDAPAV
  LGEETSAKPQMLIIERKGTRKLLNLPEVSALCEALGFAVTVAE
Full Sequence
Protein Sequence     Length: 522     Download
MASTAYSRPS KPPGPAAGDR SGPRLAKELG RIEPKKLGIG LVAGCCFALL TYLSFARLFA    60
IYSPVFDSSS SMVLKNMPPA TTTVPGTATG ALPVEEQKEV RDPEADPHMP NLPEVTEKDQ    120
QEEATATKPE AKITCDENGV DEGFPYARPP VCELAGDIRV SPKEKTMYFV NPSGAGPFDS    180
NGEKKIRPFA RKDDFLLPGV VEVTIKSVSS AAAAPRCTRR HDVPVVVFSV AGYTDNFFHD    240
NTDVLIPLFL TTAHLQGEVQ LLVTNYKPWW VRKFTPLLRK LSNYDVIDFG KDDEVHCFRA    300
GHLGMYRDRD LIISPHPTRN PRNYSMVDYN RFLRRAFNLP RDAPAVLGEE TSAKPQMLII    360
ERKGTRKLLN LPEVSALCEA LGFAVTVAEA DADVRVFAEK VNAADVLLAV HGAGLTNQIF    420
LPTGAVLVQI VPWGKMDWMA TNFYGQPARD MRLRYVEYYV SEEETTLKDK YPRDHYVFKD    480
PMHIHAQGWP AIAEIIMKQD VMVNMTRFKP FLLQALNELQ D*                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44210.000335243286+
pfam04577DUF5631.0e-12235432207+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACL54661.1015211501unknown [Zea mays]
DDBJBAD35388.1015211524putative HGA4 [Oryza sativa Japonica Group]
RefSeqNP_001057616.101521114637Os06g0470000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149180.1015211521HGA4 [Zea mays]
RefSeqXP_002437022.1015211529hypothetical protein SORBIDRAFT_10g018270 [Sorghum bicolor]
Transmembrane Domains
StartEnd
3756
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR9618532982035000
DV0295912761213960
CN1456912801183920
DR80132926512650
DT94870325912590